# Webalizer V2.01-10 Incremental Data - 05/21/2012 02:01:48 2012 5 21 2 1 48 3250 2311 207 884 55 90 33712254 2399 558 0 3 1 143 1 21 56 28 1966412 14 43 18 65 39 755646 12 31 14 168 154 3284183 23 132 31 316 300 5140416 20 281 25 150 130 1992465 18 128 33 111 91 2348727 15 56 28 122 95 1833315 26 92 28 155 88 2938159 29 102 47 146 88 1463470 16 97 29 197 145 1817733 18 155 35 182 144 771222 17 149 39 212 179 617691 16 182 32 105 43 743497 13 59 14 542 329 2780392 12 440 20 165 130 734152 18 120 18 140 113 158859 12 114 14 69 26 446216 15 34 28 76 34 669830 13 40 28 135 74 1976766 19 71 48 128 74 1162871 16 64 31 10 7 110232 3 9 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 76 49 1266489 46 83 55 700548 63 67 40 800411 32 78 43 1284803 41 105 54 706048 59 88 54 1245612 49 111 57 1107335 59 94 60 774979 59 330 249 2081946 262 161 102 3390305 98 419 387 1644571 355 276 94 1588781 255 174 159 1009619 159 148 128 1740677 118 58 50 726185 44 164 144 1493832 115 153 117 2069124 111 84 72 999748 67 125 86 2446430 82 135 101 2508509 101 55 38 552081 42 94 63 1453852 61 76 45 946621 55 96 64 1173748 66 0 0 0 2311 0 0 0 0 0 0 0 18 8 0 188 0 0 0 6 0 7 711 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 # -urls- /images/produse/10666527.311.jpg 0 1 0 0 0 0 /jobseekers-chennai-nude-teen-girls-wallpaper/ 0 1 0 14519 0 0 /cierrawith-samsonanddelilahxvidwwwhoraavi/ 0 1 0 14670 0 0 /clase/my_backgrounds/ 0 1 0 1150 0 0 /images/galerie/thumb/34.jpg 0 1 0 0 0 0 /jobseekers-jb-when-i-can-t-sing-dream-high/ 0 1 0 16007 1 0 /jackal-phatrinhtenxvideoscomdvdfulliso/ 0 1 0 15208 0 0 /coring-lord-of-the-flies-study-pack-free-epub/ 0 2 0 28420 0 1 /outlet/js/library.js 0 3 0 5166 0 0 /images/fancy_title_right.png 0 1 0 559 0 0 /js/library.js 0 2 0 4380 0 0 /dirlgram-obk-ultimatum-2008-rar/ 0 2 0 28154 1 0 /dishnetwork-dan-gibson-mp3/ 0 1 0 14201 0 0 /lis-code_lyokocompresspart01rar/ 0 2 0 29442 1 1 /shovel-4shared-episodio-1-em-3gp-de-naruto/ 0 2 0 30698 1 1 /cheyene-matrimonio_con_hijos_dvd_2part1rar/ 0 1 0 14573 0 0 /amay-contato_jodie_foster_filme_dublado_downloadxvidmp4/ 0 1 0 15414 0 0 /webalizer/hourly_usage_201011.png 0 1 0 0 0 0 /ghos-project_fileszip/ 0 3 0 46011 1 0 /clase/login.Class.php 0 1 0 0 0 0 /avnged-ai-quantu-pelu/ 0 1 0 14187 0 0 /wed-tpfiltrepassifpdf/ 0 1 0 14725 0 0 /malfunctioning-fisa-mijlocului-fixdoc/ 0 2 0 29100 0 1 /npicture-amagami-ssmorishima-haruka-04avi/ 0 1 0 15186 0 0 /apachi-filme-video-crestine-gratis/ 0 3 0 40623 1 1 / 0 840 0 793298 101 60 /kenworths-peranan-pendidikan-dalam-masyarakat-pdf/ 0 7 0 98 2 1 /grados-young_jeezy__the_inspirationrar/ 0 1 0 14769 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/doc.gif 0 1 0 0 0 0 /fckeditor/editor/css/images/fck_flashlogo.gif 0 1 0 0 0 0 /fisiere/10(1).jpg 0 1 0 0 0 0 /content/contul_meu.php 0 3 0 720 0 0 /rodz-aadu-aadinchu/ 0 1 0 15227 0 0 /sagittarius-playdom-ser-hack-en-wild-ones/ 0 1 0 14425 1 1 /hpower-swords-and-sandals-hacked/ 0 1 0 14547 0 0 /illusionist-muratcaamailru/ 0 3 0 41238 1 1 /fckeditor/editor/_source/classes/ 0 1 0 5610 0 1 /aboriginals/ 0 45 0 16199183 34 1 /empty-wadca-piercieni/ 0 3 0 41496 2 0 /folktale-extrakcio-vmii-bsc-pdf/ 0 2 0 28748 0 1 /images/produse/14079027.242_n_m_rosu.jpg 0 1 0 0 0 0 /breather-symerki-4/ 0 2 0 29838 0 0 /images/galerie/thumb/11.jpg 0 1 0 0 0 0 /webalizer/hourly_usage_201106.png 0 1 0 0 0 0 /loofah-avatar-2009-dvdripxvidac3mck-lektor-pl-arx/ 0 1 0 14483 0 0 /kicken-smell-like-sex/ 0 2 0 27904 1 0 /geolander-kensukeskingdompdf/ 0 2 0 29546 1 1 /innercooler-winzipx_free_downloadd320kbpszip/ 0 1 0 14942 0 0 /questins-mediafire-easylingo-2012/ 0 1 0 14543 0 0 /perfection-pramuka-mts/ 0 3 0 43701 3 2 /koleksyon-repack-rus/ 0 5 0 70 3 2 /pdf-kasumi_rebirth_v2crackzip/ 0 1 0 13536 0 0 /fckeditor/editor/dialog/fck_spellerpages/spellerpages/ 0 3 0 4974 3 3 /images/fancy_title_main.png 0 1 0 149 0 0 /delinquent-pompino-sofia-vergara/ 0 1 0 13964 0 0 /minimite-speedy-pc/ 0 1 0 14692 0 0 /images/produse/14894627.204_n.jpg 0 1 0 0 0 0 /ruph-patch-xbox360/ 0 1 0 13677 0 0 /images/produse/17088527.047_n.jpg 0 1 0 0 0 0 /lexan-tpimage-130/ 0 5 0 70 1 2 /images/produse/12384027.560_n_m.jpg 0 1 0 0 0 0 /fckeditor/fckutils.cfm 0 1 0 2400 0 0 /tumbled-jasc-paint-shop-pro-10/ 0 1 0 13812 0 0 /seatbealt-mcafee_security_center_key_crack/ 0 1 0 14521 0 0 /protien-my-eyes-won-t-dry-3/ 0 1 0 13005 0 0 /images/galerie/large/28.jpg 0 1 0 0 0 0 /rxe-gackt-mizerable-rar/ 0 1 0 13870 0 0 /content/creare_cont.php 0 2 0 490 0 0 /sdsale-xvideos-love/ 0 14 0 193067 10 7 /webalizer/daily_usage_201001.png 0 1 0 0 0 0 /fckeditor/editor/css/images/block_h1.png 0 1 0 0 0 0 /electrod-cover-3d-pro/ 0 1 0 13357 0 0 /bdsm-avira-premium-security-suite-10-crack/ 0 1 0 14144 0 0 /qeneras-nokia_x201_3d_gamesnewavi/ 0 2 0 30418 0 1 /winberg-andres-contreras/ 0 3 0 43683 2 1 /pfister-take_out_clothing_software_xvidrar/ 0 1 0 14512 0 1 /feb-los-cafres-quien-da-mas-mediafire/ 0 2 0 29892 1 0 /fckeditor/editor/plugins/bbcode/_sample/ 0 2 0 1778 1 1 /fckeditor/editor/filemanager/browser/default/images/icons/ 0 1 0 3933 0 1 /gayboy-hardteksamplepackcracksitx/ 0 3 0 27771 2 0 /images/produse/13662527.634_3_n_m.jpg 0 1 0 0 0 0 /ngn-the-sims-2-ipa/ 0 6 0 84 3 1 /fckeditor/license.txt 0 4 0 203139 0 0 /boatmotors-virtual-date-games-sci-fi-mission-walkthrough/ 0 5 0 78530 4 1 /webalizer/ 0 18 0 323544 8 4 /sagittarius-insanity_workout_download_dvd_ripnewzip/ 0 1 0 14838 1 1 /mardi-samsunggts5233wfirmwareupdatefull_hdwmv/ 0 1 0 15380 0 0 /acco-etica-de-la-empresa-adela-cortina-descargar-gratis/ 0 1 0 14405 1 0 /images/galerie/large/05.jpg 0 1 0 0 0 0 /images/header.jpg 0 1 0 17830 0 0 /images/produse/11506227.563_n.jpg 0 1 0 0 0 0 /sims-dog-and-girl-hot/ 0 1 0 14004 1 0 /expnation-perlen-poesie-11-free-download/ 0 1 0 14486 0 0 /laquer-pepe/ 0 1 0 14329 0 0 /fisiere/13(4).jpg 0 2 0 158785 0 0 /fisiere/file/ 0 1 0 557 0 0 /webalizer/webalizer.hist 0 2 0 958 0 0 /bushel-satanicsurferstastethepoison_2010zip/ 0 1 0 14907 0 0 /images/produse/10051727.262_n.jpg 0 1 0 0 0 0 /cckb-descargar-gratis-dvd-gatas-sandungueras-5/ 0 1 0 16170 1 1 /signgal-luomoragno-con-nicholas-hammound-serie-tv-del-60-70-ita/ 0 1 0 14224 0 0 /bore-acsea-fitness-for-work-policy/ 0 1 0 14509 0 0 /sep-gta_vice_city_tuning_2005_extreme_macosxintelsit/ 0 2 0 28566 1 1 /aja-pirates-of-the-carrabian-4/ 0 1 0 15234 0 0 /weisted-thuy-nga-104-full/ 0 1 0 14721 0 1 /images/produse/10272827.306_n_m.jpg 0 1 0 0 0 0 /durimax-raymond-chandler-veliki-sat/ 0 2 0 29350 1 1 /dispeser-nokia-e500-pack-juegos-descargar/ 0 1 0 13611 0 0 /tranfermer-krystyna-janda-przesluchanie/ 0 1 0 14018 1 1 /kerb-architecture-by-francis-dk-ching-free-ebooks-hotfile/ 0 1 0 14308 0 0 /rattle-xxx-boobs-girls/ 0 1 0 13621 0 0 /images/produse/10291227.338_n.jpg 0 1 0 0 0 0 /navigatio-duane-stephenson-discography/ 0 1 0 13769 0 0 /coach-silabuskeperawatanjiwa_finalpdf/ 0 1 0 15526 0 0 /images/galerie/large/27.jpg 0 1 0 0 0 0 /dieseling-juegos_para_alcatel_ot_706_afullwma/ 0 1 0 14145 0 0 /yardmaster-vg4160nor1049norsksomandresprakforsprakligeminoritetereksamenv09pdfnewpdf/ 0 1 0 14808 0 0 /poems-garmin-sweden-map/ 0 3 0 42711 0 3 /icc-feeling-wonen/ 0 1 0 13993 0 0 /kenworths-serial-tune-up-2009/ 0 1 0 13993 0 0 /fckeditor/fckstyles.xml 0 1 0 3450 0 0 /fckeditor/editor/images/smiley/msn/cry_smile.gif 0 1 0 0 0 0 /goucho-resident-evil-5-2009-pc-engrip-by-kaos-neo/ 0 1 0 15348 0 0 /ladt-double-door/ 0 1 0 15461 0 0 /fckeditor/editor/images/smiley/msn/kiss.gif 0 1 0 0 0 0 /clave-powermil-10/ 0 1 0 15517 0 0 /images/produse/16801427.267.jpg 0 1 0 0 0 0 /damage-digital-communication-backgrounds/ 0 1 0 15123 0 0 /haunted-descargar-discografia-grupo-nectar-4shared/ 0 2 0 31760 0 2 /suier-kalp-anatomisi-ve-fizyolojisi-ppt/ 0 2 0 27892 0 0 /erection-glass-engineering-handbook/ 0 1 0 15295 0 1 /passions-maranatha_singers_the_1983__psalms_aliverar/ 0 1 0 15831 0 0 /fisiere/8(3).jpg 0 1 0 0 0 0 /sdsale-download-free-chix-loving-black-dicks-3/ 0 3 0 48345 2 1 /fisiere/14_2(1).jpg 0 1 0 0 0 0 /quadrail-deepika/ 0 1 0 15255 0 0 /aside-manajemen-pemasaran-i-pdf/ 0 1 0 15610 1 0 /communicable-oware-abapa/ 0 1 0 14353 0 0 /hpower-discografia-txarrena-torrent/ 0 3 0 44565 2 2 /images/galerie/thumb/43.jpg 0 1 0 0 0 0 /fisiere/16(7).jpg 0 1 0 0 0 0 /dmax-lasociedaddelsemaforoonlinemegavideo_lastmpg/ 0 1 0 15139 0 0 /images/produse/11616027.116_n.jpg 0 1 0 0 0 0 /inchl-euro-2010-multigame-pc/ 0 2 0 28818 1 1 /orpington-fasciola-in-sheep/ 0 6 0 90965 3 0 /communicable-ariston-uno-24-mffi-pdf/ 0 1 0 14114 0 0 /images/btn_add_cos.gif 0 2 0 0 0 0 /nudists-the-number-23-subtitle-ro/ 0 1 0 15162 0 0 /tempter-katty-perry-sex-video/ 0 1 0 14736 0 0 /vhc-hungry-shark/ 0 1 0 13831 0 0 /fckeditor/fckpackager.xml 0 1 0 13201 0 0 /stiking-mishon-imposible-4-hindi/ 0 1 0 15161 0 0 /fibromyalgia-project-igi-jar-game/ 0 1 0 13882 0 0 /starflight-toradora-hentai-game/ 0 2 0 28238 0 0 /reductions-minecarft-11-pliki-serwerowe/ 0 1 0 14986 0 1 /salara-guide-redaction-video-2008-doc/ 0 1 0 15733 0 0 /claussen-pss-winpro/ 0 1 0 14632 0 0 /druker-punishment_for_cheating/ 0 1 0 14586 0 0 /connetor-robert-sebesta-concepts-of-programming-languages-free-download/ 0 1 0 13942 0 0 /content/finalizeaza.php 0 5 0 1923 0 0 /concole-buffycontrelesvampiressaison8crackzip/ 0 1 0 15078 0 0 /images/produse/10712127.713_n.jpg 0 1 0 0 0 0 /shn-playstationnetworkcardcodegratuitcrackrar/ 0 1 0 15048 0 0 /haflinger-15-exitos-grupo/ 0 1 0 14439 0 0 /cdrs-u2-live-at-glastonbury-festival-24062011/ 0 2 0 29632 0 0 /iassic-honda-whereis-navigation-data-au/ 0 2 0 27780 0 0 /chevrole-ruben_studdard__love_is_retailzip/ 0 1 0 14301 0 0 /fckeditor/editor/filemanager/connectors/php/ 0 1 0 1618 0 0 /envirofire-nanomaterials/ 0 1 0 13824 0 0 /daycare-blood-and-gold-the-americas-at-war/ 0 2 0 28020 1 1 /conquests-descargarpackdemusicadebandalomejordel2011tswmv/ 0 1 0 15746 1 1 /fisiere/10(3).jpg 0 1 0 0 0 0 /boatlift-working-in-groups-communication-principles-and-strategies-4th-edition-by-isa-n-engleberg-dianna-r-wynn-pdf/ 0 1 0 15685 1 0 /apu-du-r-alltid-en-del-utav-mig/ 0 1 0 13705 1 0 /tailpiece-book-torrent-the-triumph-of-the-american-imagination/ 0 2 0 29106 1 1 /js/ 0 8 0 9432 1 1 /clase/my_backgrounds/bg_1.png 0 1 0 0 0 0 /images/produse/12942527.310_n_m.jpg 0 1 0 0 0 0 /europeas-advancedsystemcare5prokeygen_setuprar/ 0 1 0 16329 0 0 /pogramas-le-allegre-comari-di-rossor-avi/ 0 2 0 32722 0 1 /graphing-cd-scorpions-acoustica-download-mediafire/ 0 5 0 70 1 1 /sdsale-alleta-squirt/ 0 1 0 14408 1 1 /outlet/js/prototype.js 0 4 0 197732 0 0 /ballancing-la-vita-atildeuml-bella/ 0 2 0 29762 1 0 /mehren-dvd-flick-1307-__-keygen-__/ 0 2 0 28550 0 0 /upg-pc-worms-armageddon-new-pc-edition-1999-eng/ 0 1 0 15877 0 0 /submisersiable-campfire-legends-2-the-babysitter-walkthrough-big-fish/ 0 6 0 84 4 4 /faund-jab-comics-scans-mediafire/ 0 1 0 14769 1 1 /bush-left4dead1keygenlastmkv/ 0 2 0 28028 0 1 /images/produse/12143327.602-05_n.jpg 0 1 0 0 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/html.gif 0 1 0 0 0 0 /mdb-dp066/ 0 3 0 40299 2 2 /taursus-el_poder_del_metabolismo_pdf2010mpg/ 0 1 0 15571 0 0 /trimline-harry-potter-half-blood-prince-by-stephen-fry/ 0 1 0 14044 0 0 /images/produse/10796127.357.jpg 0 1 0 0 0 0 /images/galerie/thumb/42.jpg 0 1 0 0 0 0 /een-camera360-apk/ 0 2 0 27792 2 0 /images/galerie/large/03.jpg 0 1 0 0 0 0 /images/ 0 8 0 69156 1 1 /feces-free_pass_meeticnewzip/ 0 1 0 15704 0 0 /fckeditor/editor/skins/default/images/toolbar.arrowright.gif 0 1 0 0 0 0 /cavailer-wibucodemeteremulatordownload720bpswmv/ 0 1 0 14534 0 0 /speck-soilwork-like-the-average-stalker/ 0 5 0 70 0 1 /muscales-vettai-tamil-video-songs/ 0 1 0 13706 0 0 /blazed-fairy-tail-ova-2/ 0 1 0 14389 0 0 /fisiere/14_2(2).jpg 0 1 0 0 0 0 /webalizer/daily_usage_201105.png 0 1 0 0 0 0 /tinjuana-midi_ayu_ting_ting_asik_20107zip/ 0 1 0 14560 1 1 /fastback-el-pensamiento-criminologico-pdf/ 0 1 0 15220 0 0 /cmyk-janna-friske-avi/ 0 1 0 14910 0 0 /upcamper-meninas-de-13/ 0 1 0 13807 0 0 /enter-princezito_tsmkv/ 0 2 0 31998 1 1 /atrichia-bewerbung-2012-muster/ 0 1 0 14335 0 0 /tempter-vampire-moon-book-2/ 0 1 0 13853 0 0 /fckeditor/fckeditor.lasso 0 1 0 3949 0 0 /watermelon-uncensored-voyeur/ 0 2 0 28796 0 1 /tibiron-lost-lagoon-2-cursed-ang-forgotten-big-fish-walkthrough/ 0 1 0 14710 0 0 /images/galerie/large/25.jpg 0 1 0 0 0 0 /spolier-an_introduction_to_bioinformatics_algorithms_solution_manualcookbook7zip/ 0 1 0 15358 0 0 /morrowind-computed-tomography-physical/ 0 1 0 16034 0 0 /cartoons-when_pop_hits_the_fanzip/ 0 1 0 15157 0 1 /downloads-digimon-world-1-rom/ 0 1 0 13558 0 0 /akuza-paulo-coelho-aleph-pdf-francais-telechargement-gratuitrar/ 0 1 0 14906 0 0 /forida-kingdom_of_seven_seals_deluxerar/ 0 1 0 15304 0 0 /contessa-crckmaxwellrendersketchuptutorialcookbookdjvu/ 0 1 0 13765 0 0 /samuri-progrmando-pic/ 0 1 0 14103 0 0 /instruuctions-11-days-11-nights-part-3/ 0 1 0 14643 0 0 /fordsix-discografia-javier-solis-taringa-320kbps/ 0 1 0 15147 0 0 /images/produse/12539527.635_3.jpg 0 1 0 0 0 0 /purdom-addicted-dynasty-mediafire/ 0 3 0 43704 2 1 /images/fancy_shadow_sw.png 0 2 0 221 0 0 /ajax/newsletter.php 0 2 0 42 0 0 /content/produs.php 0 4 0 400 0 0 /npicture-sgt-frog-soundtrack/ 0 5 0 72650 1 3 /webalizer/daily_usage_200910.png 0 1 0 0 0 0 /images/produse/15495227.004.jpg 0 1 0 0 0 0 /fckeditor/editor/css/images/block_div.png 0 1 0 0 0 0 /fckeditor/editor/skins/silver/images/toolbar.end.gif 0 1 0 0 0 0 /travertine-selingkuh-isteri-tetangga-via-ziddu/ 0 1 0 13712 0 0 /cartoons-final-fantasy-hentai-4shared-video/ 0 3 0 42201 1 0 /elliptical/ 0 8 0 5328 1 0 /hospitals-dbh_tenth_anniversary_editionzip/ 0 2 0 25964 1 0 /morin-easy-mp3-joiner/ 0 1 0 13295 0 0 /bigtight-dive-human/ 0 2 0 28892 0 0 /norwich-soaluasagamaislamkelas12smkfulltargz/ 0 1 0 14510 0 0 /cartas-in_land_of_dreamsrar/ 0 2 0 29924 0 1 /images/galerie/thumb/41.jpg 0 1 0 0 0 0 /cofes-kiss-konfidential-xtreme-close-up-dvds/ 0 1 0 14165 1 0 /fisiere/13_1.jpg 0 1 0 0 0 0 /images/fancy_shadow_n.png 0 1 0 129 0 0 /content/error.php 0 1 0 0 0 0 /europeas-free-3gp-indonesia-fucking/ 0 1 0 14959 0 0 /coid-los-caballeros-de-la-moto-1981/ 0 2 0 29934 1 1 /dysfunction-50centgetrichordietryinfullalbumtizzlemacversiondmg/ 0 1 0 15892 0 1 /muzzloaders-morrissey-lyrics-pdf/ 0 1 0 15038 0 0 /illusionist-kavalar_kudirupu/ 0 1 0 14404 1 0 /electrod-rymowana-gimnastyka-dla-smyka-pdf-download/ 0 1 0 14454 0 0 /ibra-crack-adobe-photoshop-elements-10/ 0 2 0 29742 2 0 /webalizer/hourly_usage_201102.png 0 1 0 0 0 0 /images/galerie/large/58.jpg 0 1 0 0 0 0 /upperintakemanifoldtorque-fantasmi-alla-riscossa-megaupload/ 0 2 0 28376 1 1 /pring-leg-fisting/ 0 1 0 14072 0 0 /cuisinart-harrylouisnudephoto_fullflac/ 0 2 0 27832 0 1 /cuisinart-collapse-how-societies-choose-to-fail-or-succeed/ 0 2 0 27588 2 2 /fad-spank-wespank-net-real-punishment-of-children/ 0 1 0 14599 0 0 /rattle-100423-misaki-hd-wmv/ 0 1 0 14463 0 0 /celect-seek-bromance-video-explanation/ 0 1 0 13590 1 0 /images/visa.jpg 0 1 0 0 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/cs.gif 0 2 0 0 0 0 /fuil-1102/ 0 3 0 46686 1 0 /misket-max-carioca-g/ 0 1 0 13980 0 0 /fckeditor/editor/filemanager/browser/ 0 1 0 754 0 0 /webalizer/ctry_usage_201107.png 0 1 0 0 0 0 /images/galerie/thumb/63.jpg 0 1 0 0 0 0 /huggins-szent-johanna-gimi-4-letlts/ 0 1 0 13779 1 1 /images/galerie/large/24.jpg 0 1 0 0 0 0 /fckeditor/editor/skins/silver/ 0 1 0 1220 0 1 /poseable-catia-v6-software/ 0 1 0 13197 0 0 /trivent-here-comes-goodbye-mediafire/ 0 5 0 70 1 2 /fckeditor/editor/filemanager/browser/default/images/icons/default.icon.gif 0 1 0 0 0 0 /images/produse/13502427.272_n_m.jpg 0 1 0 0 0 0 /popet-persona-4-soundtrack-mp3/ 0 6 0 84 1 2 /meu-wilcom-2006-sp4-r2-_windows-7-eng/ 0 1 0 14459 0 0 /images/produse/12633527.627_n.jpg 0 1 0 0 0 0 /riptide-mxr6927-hapi-happyzip/ 0 1 0 14884 0 0 /dana-los-agresivos-de-la-sierra/ 0 2 0 30330 0 0 /assortment-one-piece-510_sd-wwwdragonzonlinecom-by-helrozar/ 0 1 0 13298 1 0 /icons/folder.gif 0 5 0 900 0 0 /johanson-steven-king-ebooks/ 0 1 0 14665 0 0 /abandom-videos-insesto-madre-hijo-gratis/ 0 1 0 14611 0 0 /wheelkey-tom-e-jerry/ 0 1 0 14588 1 0 /bounce-sony_ericsson_iconsrar/ 0 1 0 15393 0 0 /fisiere/12(2).jpg 0 1 0 0 0 0 /fckeditor/editor/skins/office2003/images/toolbar.collapse.gif 0 1 0 0 0 0 /shootout-michael-jacskson-history-tour/ 0 1 0 13349 0 0 /mccarthy-leyla_black_follando_despues_de_entrenar_torrent2010flv/ 0 1 0 15755 0 0 /_vti_cnf/ 0 5 0 2741 2 2 /fisiere/18_1(4).jpg 0 1 0 0 0 0 /jynx-g-d-p-g-l-e-v1-5-apk/ 0 2 0 29888 0 0 /images/produse/14105427.062.jpg 0 1 0 0 0 0 /wed-ed-sheeran-you-need-me-i-dont/ 0 1 0 14480 0 0 /critics-agusn73/ 0 1 0 13982 0 0 /webalizer/webalizer.current 0 24 0 881156 0 0 /inetgiant-firmware_pack_rm_304_v05_91_2010djvu/ 0 2 0 29570 1 1 /css/jquery.fancybox.css 0 2 0 10624 0 0 /leveled-pink-prison-streamrar/ 0 1 0 14989 0 0 /wilcox-inuyasha-italiano/ 0 1 0 14641 0 0 /js/jquery.pngFix.pack.js 0 3 0 7506 0 0 /contessa-pinball_lethal_weapon_3_descargar_taringa_portable_finalversionsitx/ 0 1 0 13310 1 1 /aco-sqlexpr/ 0 1 0 14419 0 0 /caldina-donload-pokemon-fire-red/ 0 1 0 15042 0 0 /ladt-hall-sekly-vzben/ 0 2 0 29116 1 0 /template/footer.php 0 2 0 3648 0 0 /thnuderbird-making-software-what-really-works-and/ 0 1 0 14966 0 0 /pestol-angeles-del-abismo-pdf/ 0 1 0 13826 0 0 /siliencer-inna-s-rar/ 0 1 0 13946 0 0 /mdb-donde_puedo_descargar_videos_porno_de_mujeres_virgenes_para_nokia_c3iphonempg/ 0 1 0 13954 0 1 /sterilzation-wii-sports-ostrar/ 0 1 0 15721 0 0 /coloe-crazy-models-34-48-rar-pass/ 0 1 0 14382 0 0 /aster-molesterolontraintsubasaamamiavirar/ 0 1 0 15501 0 0 /atgames-vettai-tsrip-3-tamilmobilemovies/ 0 1 0 15409 1 0 /fisiere/15_2(2).jpg 0 2 0 0 0 0 /bueprint-polytones/ 0 1 0 14144 1 1 /romance-chuck-s-02/ 0 1 0 13487 0 0 /elenatera-fisiopatologia_obesidad_infantillastpdf/ 0 1 0 14761 0 0 /webalizer/ctry_usage_201106.png 0 1 0 0 0 0 /firebrick-whatapp-hd2-windows/ 0 1 0 16406 0 0 /eang-keri-windsor-sexual-boundaries/ 0 1 0 13059 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/32/png.gif 0 1 0 0 0 0 /images/fancy_shadow_se.png 0 2 0 239 0 0 /todisc-akita-films/ 0 3 0 43925 1 1 /images/produse/16088227.604.jpg 0 1 0 0 0 0 /ments-hypocrisy-extreme-divinity/ 0 1 0 14907 0 0 /hig-wizards-crown/ 0 5 0 70670 4 1 /titany-fichas-de-calculo/ 0 1 0 15098 0 0 /evangelest-mistletoe-by-justin-bieber/ 0 2 0 28360 1 1 /pender-watssapn97minicook_bookchm/ 0 1 0 13809 0 0 /images/produse/10808627.376.jpg 0 1 0 0 0 0 /outlet/js/slideshow.js 0 4 0 49612 0 0 /outlet/js/lightbox_p.js 0 4 0 23696 0 0 /icc-torrent-de-ritmo-quente-dublado/ 0 1 0 13967 0 1 /images/produse/11211227.410_verde.jpg 0 1 0 0 0 0 /kerb-bruno-mars-marry-you-4shared/ 0 2 0 29918 0 0 /matematik-ballin-young-jeezy-mediashare/ 0 1 0 13965 0 0 /atire-how-to-play-harmonica/ 0 1 0 14361 0 0 /whiskey-stellar_phoneix_serial/ 0 1 0 15552 0 1 /daonload-david-guetta-sweat-instrumental-zippy/ 0 2 0 30636 0 1 /svbd-raccolta-video-musicali-italia/ 0 2 0 29537 1 1 /ergodyne-prisma_a1_audio_downloadmp3/ 0 1 0 15283 0 0 /outlet/images/intro.gif 0 1 0 0 0 0 /fisiere/13_1(1).jpg 0 1 0 0 0 0 /images/produse/12938127.561_n.jpg 0 1 0 0 0 0 /lantino-nokia_connectivity_cable_driver_rel_6_85_10_0_thamsi/ 0 1 0 14758 0 0 /wuesthof-xp-slovak-languere/ 0 2 0 27506 0 0 /europeas-lorenzo_dvd_ora_tour/ 0 1 0 14249 0 0 /assi-new-satzo-password-hacking-software-v2-4/ 0 2 0 28730 0 0 /matematik-bakugan-gundalian-invaders-psp/ 0 3 0 44364 1 0 /atkexotics-free-unlimited-email-address-hosting/ 0 1 0 14850 0 0 /webalizer/ctry_usage_201010.png 0 1 0 0 0 0 /softtale-just-dance-somer/ 0 1 0 14316 0 0 /karte-tom-jones-its-not-unusual-live/ 0 1 0 14760 0 0 /images/produse/15127527.164_n_m.jpg 0 1 0 0 0 0 /images/galerie/thumb/50.jpg 0 1 0 0 0 0 /mfgs-014111pdfd189484068/ 0 2 0 29134 1 0 /popsicle-asik-mahzuni-serif/ 0 1 0 14167 0 0 /images/produse/23973727.335_n_m.jpg 0 1 0 0 0 0 /boatmotors-juvenile-renevation/ 0 1 0 14252 0 0 /crj-i_cant_stop_remixesrar/ 0 1 0 14410 0 0 /js/jquery.easing.1.3.js 0 2 0 16194 0 0 /enable-fourths-for-guitar-pdf/ 0 1 0 15278 0 0 /scripps-corona__1995__baby_baby_musikarar/ 0 2 0 28224 2 0 /stix-youtube-69/ 0 1 0 14950 1 0 /bueprint-kuwari-dulhan/ 0 1 0 13664 0 0 /sywstem-gigi-star/ 0 1 0 15017 0 0 /firepower-tsila-dvd/ 0 1 0 13475 0 0 /bdsm-patch-archicad-143004/ 0 1 0 14351 0 0 /sampning-limpieza-con-nutrilite/ 0 1 0 12769 0 0 /lis-k0157_shizuko_masuda_lozip/ 0 1 0 13888 0 0 /images/item_mobil.png 0 2 0 1536 0 0 /whining-www-sex89-com/ 0 2 0 27678 2 0 /dispener-gforcemtronprov10vstidxirtasauhybriddvdrdynamics/ 0 3 0 30351 1 1 /fluorescents-lmfao-get-crazy-instrumental-mediafiretorrent/ 0 1 0 15968 0 1 /sill-neobux-hacker-descargar/ 0 1 0 14115 0 0 /maharashatra-gta-4-free-download-pc-game-torrent/ 0 1 0 13912 0 0 /webalizer/hourly_usage_201111.png 0 1 0 2155 0 0 /fckeditor/editor/skins/default/ 0 1 0 1222 0 0 /icons/blank.gif 0 36 0 5032 0 0 /images/produse/11903727.634_4_n.jpg 0 1 0 0 0 0 /hikes-iatkos-l2-os-x-lion-10-7-2-mac-os-x/ 0 1 0 14145 1 0 /css/style.css 0 2 0 26738 0 0 /images/produse/13644927.668.jpg 0 1 0 0 0 0 /replacemrnt-fifa-2012-iphone-megaupload/ 0 1 0 13600 0 1 /images/produse/1240927.234.jpg 0 1 0 0 0 0 /images/produse/12690027.496_n.jpg 0 1 0 0 0 0 /dripper-tsukuyomi-moon-phase-26-mp4/ 0 2 0 28328 0 1 /percentle-paypal-database-activation/ 0 1 0 13458 0 0 /awstats/icon/os/ 0 1 0 580 0 0 /fisiere/17(3).jpg 0 1 0 0 0 0 /rights-mechanical-engineering-ppt/ 0 1 0 14286 0 0 /webalizer/hourly_usage_201009.png 0 1 0 0 0 0 /disassembling-due-pattini-per-la-gloria-ita/ 0 1 0 14438 0 0 /egale-full_version_monopoly_allzip/ 0 1 0 15174 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/xml.gif 0 1 0 0 0 0 /hackintosh-fansadox-sickest-15-zerns-and-tourpdf/ 0 1 0 14620 0 0 /stoc.jpg 0 1 0 29961 0 0 /fckeditor/editor/css/behaviors/showtableborders.htc 0 1 0 822 0 0 /protectors-digimon-tamers-ongaku-no-shuu-ver-2/ 0 7 0 98 4 4 /awstats/icon/ 0 2 0 1574 1 0 /american-harti-gps-free/ 0 1 0 13196 0 0 /images/galerie/large/44.jpg 0 1 0 0 0 0 /images/fancy_title_left.png 0 1 0 556 0 0 /tipicas-free-download-sexvilla-1/ 0 1 0 15106 0 1 /content/contul_meu 0 2 0 488 2 2 /jayfllight-psikey-dll-corel-x5-full-megauploadtorrent/ 0 3 0 44379 1 1 /haflinger-ebook-particle-illusion-pdf/ 0 1 0 13463 0 0 /transference-panoweaver-7-seriakl/ 0 1 0 13677 0 0 /aboriginals/straier.php 0 2 0 5642 0 0 /cmyk-mletacki-trgovac/ 0 1 0 14318 0 0 /hoppe-elegidos-para-la-gloria-torrent/ 0 1 0 14272 0 0 /images/produse/14072227.299_n.jpg 0 1 0 0 0 0 /outlet/lightbox.css 0 4 0 9504 0 0 /exeter-two-timer-ara-mina-video/ 0 1 0 14413 0 0 /throtlebody-star-wars-episodio-i/ 0 1 0 13724 0 1 /proheat-coreldrawx5languagepackptbrmegauploadiso-portuges/ 0 1 0 14315 0 0 /stw-vedikkettukari-shakeela-watch-onlinerar/ 0 2 0 28512 1 0 /dawloads-i-need-a-dollar-acapella-aloe-blacc/ 0 1 0 14923 0 0 /age-latamangeshkarlegendscd3320kbpssongspkfullrar/ 0 1 0 14733 0 0 /jynx-trijntje-oosterhuis-the-look-of-love-2006-mp3320kbpscovers/ 0 1 0 13623 0 0 /cavailer-font-cyne/ 0 1 0 13883 0 1 /thnuderbird-apple-mobile-device-driver-mediafire/ 0 2 0 27828 1 1 /fisiere/12(4).jpg 0 1 0 0 0 0 /icons/image2.gif 0 5 0 1545 0 0 /farenheiht-pojkart-yamad-boy-marco2/ 0 3 0 39177 2 1 /fisiere/image/ 0 1 0 559 0 1 /webalizer/daily_usage_201112.png 0 1 0 3446 0 0 /claussen-agneepath-hindi-2012-dvdscr-xvidltr/ 0 1 0 14091 0 0 /content/recuperare_parola 0 2 0 2144 1 1 /melenium-monica-sweet-le-dorlis/ 0 1 0 13920 0 0 /images/galerie/thumb/60.jpg 0 1 0 0 0 0 /hackintosh-justin-bieber-themes-for-nokia-2690torrent/ 0 2 0 29108 1 0 /clase/general.Class.php 0 1 0 0 0 0 /admin/css/style.css 0 1 0 5319 0 0 /freewere-super-sex-teen/ 0 1 0 14240 0 0 /mpreg-tricot-2011/ 0 1 0 13822 0 0 /introduction-timbaland-apologize-instrumental-mp3/ 0 1 0 15579 0 0 /chandilier-spca1528-mac-driver-torenttorrent/ 0 1 0 13414 1 0 /mpreg-chuck-no-captain-chunk-2010-mediafire-full-free/ 0 2 0 27652 0 0 /fckeditor/editor/dialog/fck_about/sponsors/ 0 1 0 783 1 0 /starflight-oscar-benton-bensonhurst-blues-1981/ 0 1 0 15079 0 0 /tighening-creepsharecom_sophiasantierotavi/ 0 1 0 14684 0 1 /roundwood-lacie-heart-1080p/ 0 3 0 39876 0 2 /content/ 0 8 0 20840 1 1 /magizne-key-activate-avs4you-navigator/ 0 1 0 15035 1 0 /hackintosh-greta-y-los-garbo-no-te-fallare/ 0 1 0 14563 0 0 /communit-damian-lazarus/ 0 4 0 55304 3 1 /fckeditor/fcktemplates.xml 0 1 0 2959 0 0 /tibiron-india_nude_show3gp/ 0 1 0 15000 0 0 /fck_files/ 0 7 0 3813 0 0 /shin-oceane-dream-set/ 0 1 0 14455 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/32/fla.gif 0 1 0 0 0 0 /fckeditor/fckeditor.js 0 1 0 9523 0 0 /images/galerie/large/43.jpg 0 1 0 0 0 0 /grayson-gaiola-das-loucas-dublado-torrent/ 0 1 0 14736 1 1 /sexe-airbender-el-ltimo-guerrero-2010/ 0 1 0 15424 0 0 /huggins-cproxy_30_fullzip/ 0 2 0 28722 0 1 /stgb-stonewords/ 0 1 0 13120 0 0 /enable-groping-chikan/ 0 1 0 14896 0 0 /fuji-batuka_cardiofit/ 0 2 0 29014 1 1 /jojo-leica_geo_office_6_downloaddvdfullzip/ 0 1 0 14262 1 0 /images/galerie/large/ 0 1 0 8586 0 1 /pogramas-andres-cepeda-me-voy-mp3/ 0 1 0 15066 1 0 /fckeditor/editor/ 0 2 0 4410 0 1 /content/galerie.php 0 1 0 199 0 0 /images/produse/10106627.115_n_m.jpg 0 1 0 0 0 0 /regetton-banda-gerd-vol-5/ 0 1 0 14386 0 0 /destruction-asc-v50-keygen-by-fff/ 0 1 0 15814 0 0 /fckeditor/editor/images/smiley/msn/thumbs_up.gif 0 1 0 0 0 0 /peludo-temptation2/ 0 1 0 14877 1 0 /fckeditor/fckeditor.cfc 0 1 0 8830 0 0 /igntion-discografia-flotsam-and-jetsam-mediafire/ 0 4 0 43538 2 0 /images/galerie/thumb/19.jpg 0 1 0 0 0 0 /fckeditor/fckeditor.cfm 0 1 0 7024 0 0 /awstats/ 0 7 0 4576 0 0 /contessa-aprende_openxava_con_ejemplosrar/ 0 1 0 14092 0 0 /scematics-colombiana-blu-ray/ 0 1 0 14941 0 0 /supplex-winzip_pro_1007245_serial_maker/ 0 1 0 13668 0 0 /supar-industrial-modbus-tcp-ethernet-to-modbus-rtu-ascii-serial-controller-pdf/ 0 1 0 16455 0 0 /icons/unknown.gif 0 32 0 7350 0 0 /webalizer/daily_usage_201111.png 0 1 0 3828 0 0 /images/galerie/large/20.jpg 0 1 0 0 0 0 /sdlx-babylon-8-crack/ 0 6 0 84 1 2 /enable-socialempireshacktoolv25allzip/ 0 1 0 15206 0 0 /colfor-twixtor_activation_problem_mediafirewin327zip/ 0 1 0 14409 0 0 /steiner-l-affaire-katsumi/ 0 1 0 14964 0 0 /images/produse/13422927.656_n_m.jpg 0 1 0 0 0 0 /tailpiece-cantata-maior-amor-de-john-w-peterson-arr-de/ 0 1 0 14816 0 0 /hoppe-bengali-teen-girl-fuck/ 0 6 0 84 1 2 /continental-sistar-so-cool-1080p/ 0 1 0 14636 0 0 /empty-ui-view32-v202/ 0 1 0 14183 0 0 /inchflexi-emeli-sand-heaven/ 0 1 0 14188 0 0 /images/produse/11137327.216_n.jpg 0 1 0 0 0 0 /feb-solucionario-larson-8-edicion-pdf/ 0 2 0 14346 1 0 /leveled-lisasoghayaramp3r/ 0 3 0 42984 2 0 /barby-autodeskinventorprofessional2012crackfinalpdf/ 0 1 0 14864 0 1 /jinchuuriki-explicite-art-solo/ 0 1 0 15050 0 0 /throught-schag-den-raab-wii/ 0 2 0 27922 1 0 /partout-madden_nfl_2002zip/ 0 1 0 15422 0 1 /diagraeme-pop2-rar/ 0 2 0 26900 0 0 /korban-mohombi-ft-nicole-scherzinger-coconut-tree-f-a-r-s-k-i-d-s-128/ 0 1 0 14837 0 0 /throtlebody-descargar-system-l2chile-gracia-final/ 0 2 0 28958 1 0 /clase/show_code.php 0 1 0 4939 0 0 /minatures-kudakuda-doc/ 0 3 0 42237 3 1 /febrero-marimba-concerto-score-coverpdf/ 0 1 0 15187 0 0 /mal-tae-bae-bae-snatchin/ 0 1 0 14007 0 0 /leyton-grove-agant/ 0 2 0 27804 0 2 /images/galerie/large/42.jpg 0 1 0 0 0 0 /electrocuted-manila-exposed-12/ 0 2 0 27774 0 1 /fckeditor/editor/filemanager/browser/default/images/icons/png.gif 0 1 0 0 0 0 /aftermaeket-carib-whole-hd2/ 0 2 0 15194 1 0 /restuarant-arabsquadcombymrhassanomsi_the_bus_simulatorskidrowpart1/ 0 3 0 45042 2 1 /storefront-audrey-bitoni-download-movies-4shared/ 0 1 0 15929 0 0 /upholtstered-big-bang-iso/ 0 1 0 15613 0 0 /shostakovich-bsnp-kisikisi-ujian-tengah-semester/ 0 1 0 13715 0 1 /cathyscraving-ulead-3d-studio-2012/ 0 1 0 13852 0 0 /images/galerie/thumb/07.jpg 0 1 0 0 0 0 /fisiere/catalog2-fata(1)(1).jpg 0 1 0 0 0 0 /expnation-lamaisondemickeylachasseauavi/ 0 2 0 30062 0 0 /tibiron-avast-internet-security-6-0-13/ 0 1 0 15864 0 0 /fisiere/11.jpg 0 1 0 0 0 0 /communicable-williwaw/ 0 2 0 27622 0 0 /uetero-athletics-biomechanice-analysis-software-free-download/ 0 1 0 15580 0 0 /images/footer.jpg 0 1 0 85923 0 0 /images/produse/35946727.694_n_m.jpg 0 2 0 12957 0 0 /stampeed-vmware-view-apk/ 0 1 0 14332 0 0 /golfster-avg-internet-security-2012-seri/ 0 1 0 14391 0 0 /faund-sni-0624801991-badan-standardisasi-nasional/ 0 1 0 15204 0 0 /treadted-xentry-installation-toolstorrent/ 0 1 0 14147 0 0 /icons/text.gif 0 34 0 7328 0 0 /fckeditor/editor/css/images/block_blockquote.png 0 1 0 0 0 0 /images/galerie/thumb/18.jpg 0 1 0 0 0 0 /js/jquery-1.3.2.min.js 0 2 0 72813 0 0 /fckeditor/fckeditor.afp 0 1 0 4307 0 0 /ioniser-tecdoc2012keygen_fullpdf/ 0 3 0 43824 1 0 /images/galerie/ 0 1 0 788 0 0 /exp-ita-il-figlio-di-babbo-natale/ 0 1 0 14536 0 0 /content/pagini.php 0 3 0 195 0 0 /trition-combat-arms-nx-hack-amasan-anan-sikerim/ 0 2 0 28688 1 1 /fckeditor/fckeditor.py 0 2 0 8742 0 0 /vesicles-takumi_kun_5_eng_sub_goodqualityrar/ 0 1 0 14680 0 0 /fisiere/ 0 11 0 397231 5 4 /haas-led-zeppelin-in-throught-the-out-door-03/ 0 1 0 14914 0 0 /monk-homunculus-girlfriend/ 0 1 0 14283 0 0 /grados-zs211_drv_6211_070704_setupexe/ 0 2 0 28588 1 0 /elenatera-texture_sets_for_mwd_win_64_dvdfulliso/ 0 1 0 14118 1 0 /xls-amber-spanks-star/ 0 1 0 14459 0 0 /images/culori.gif 0 1 0 0 0 0 /content/cos.php 0 4 0 1292 0 0 /rights-hip-hop-drums-xxl/ 0 2 0 27766 1 0 /content/creare_cont 0 3 0 753 3 3 /fisiere/14(3).jpg 0 1 0 0 0 0 /fuelregulator-va-gospel-songs-collection/ 0 1 0 15035 0 0 /rights-rally_polandrar/ 0 1 0 14889 0 0 /aster-david-bartholom/ 0 1 0 14486 0 0 /haymarket-toolwiz_care_100580/ 0 1 0 14156 0 0 /clase/ 0 8 0 14272 0 0 /emargency-free-ebook-data-mining-techniques-arun-k-pujari/ 0 1 0 14920 0 1 /killo-bmw-3er-e36-jetzt-helfe-ich-mir-selbst/ 0 2 0 30060 1 1 /goodbyes-240x320-free-java-games/ 0 1 0 15237 0 0 /traces-kateikyoushi-no-oneesan/ 0 1 0 14724 0 0 /amarica-solution-manual-of-dsp-by-salivahanan/ 0 1 0 17415 0 0 /steiner-tlchargerpatcharabepes6pes12liveflac/ 0 1 0 14252 0 0 /carly-sineadoconnorseannosnua2002apecdripwma/ 0 2 0 27532 1 2 /fckeditor/editor/css/behaviors/disablehandles.htc 0 1 0 236 0 0 /larceny-trend_micro_pc_cillin_internet_security_2007_serial_keygenrar/ 0 1 0 14923 1 1 /images/produse/ 0 2 0 347220 1 1 /compasses-spolszczenie-do-heavyweight-thunder/ 0 3 0 44469 1 2 /mehren-filemaker_keygen_/ 0 2 0 28526 1 1 /images/produse/13477927.556_n_m.jpg 0 1 0 0 0 0 /rradio-pacman_world_racing_rar/ 0 2 0 30074 1 1 /jenson-hot-banditoz-shake-your-ballamp3/ 0 1 0 15258 0 0 /images/item_telefon.png 0 2 0 1450 0 0 /hydroxy-xap-wp7-mu-full-megaupload-hotfilerar/ 0 2 0 28670 1 1 /flukes-madam-bovary-edwige-fenech/ 0 1 0 14117 0 0 /fiore-within-tempatation-the-unforgiven/ 0 1 0 15365 0 0 /shared-mirrored-park-shin-hye-satisfaction/ 0 5 0 70 2 0 /tighening-hp-514-game-cab/ 0 1 0 14444 0 0 /nteractive-bbc-pbs-nova-vikings-pagans-indians-incas-natural-history-and-evolution/ 0 1 0 14805 0 0 /lolico-os-update-for-corby2/ 0 1 0 14466 0 0 /bushwacker-bioconductor-case-studies-pdf/ 0 1 0 14313 0 0 /outlet/lightbox_p.css 0 4 0 3820 0 0 /enable-wm61_mpx200_by_win_xp_englishirar/ 0 1 0 13983 0 0 /doa-solution_statistical_quality_control_montgomeryfullrar/ 0 1 0 16762 0 0 /billings-2cutenessesm/ 0 1 0 13649 0 0 /submisersiable-dolores-cannon-convoluted-universe/ 0 2 0 27526 1 1 /sdlx-winrar-for-mincraft/ 0 1 0 15160 0 0 /darango-avi-letlts-suzy-album/ 0 2 0 26286 0 1 /images/produse/15187427.575_n.jpg 0 1 0 0 0 0 /images/galerie/large/52.jpg 0 1 0 0 0 0 /teaher-bboy-the-game-pc/ 0 1 0 14002 0 0 /images/produse/1150027.003_n_m.jpg 0 1 0 0 0 0 /diagraeme-officexplitecrackrar/ 0 1 0 13704 0 0 /beartracker-downloadgranny2dll2009_allzip/ 0 1 0 16331 0 0 /bigtight-home-for-all-creative-rationale-2006-pdf/ 0 3 0 42495 1 2 /limburg-sim-seeds-of-hope-mp3-mediafire/ 0 1 0 14256 1 1 /fckeditor/editor/dialog/common/images/ 0 1 0 997 1 0 /protien-the-number-one-asset-you-should-own-in-a-time-of-crisis-full-free/ 0 3 0 41676 2 0 /images/galerie/large/63.jpg 0 1 0 0 0 0 /fckeditor/fckeditor.php 0 3 0 10 0 0 /sngle-drake_take_care_wav_download_720bpswmv/ 0 1 0 16179 0 0 /thicknes-focke-wulf-fw-190/ 0 1 0 13670 0 0 /pickerington-drivers-naviroute-gps/ 0 1 0 13896 0 0 /fluorescents-long-mint-glass-toy-hdwmv/ 0 1 0 15142 0 0 /clase/categorii.Class.php 0 1 0 0 0 0 /fckeditor/editor/skins/office2003/images/ 0 1 0 2155 0 1 /clase/clienti.Class.php 0 1 0 0 0 0 /protien-big-ass-cheerleader/ 0 1 0 15014 0 0 /webalizer/daily_usage_201007.png 0 1 0 0 0 0 /content/contact.php 0 1 0 204 0 0 /seltzer-glory_rome_patchfullexe/ 0 1 0 14199 0 0 /incompatible-selena-gomez-and-the-scene-kiss-and-tell/ 0 1 0 14494 1 1 /minatures-wap-1st-time-sex-bool/ 0 1 0 13509 0 0 /ecole-downloadpokemonmiragegba4shared_320kbpsrar/ 0 2 0 30836 0 0 /frends-wiz_khalifa__say_yeah_prod_bymp3/ 0 1 0 14592 0 0 /equalized-sonohanabirawatchonline1080bpszip/ 0 3 0 44058 2 0 /lis-montenegro-1981/ 0 2 0 30656 0 0 /invoicing-cubex-v30/ 0 1 0 13739 0 0 /essbase-bennuts2159rar/ 0 1 0 13392 0 0 /shovel-the_lonely_island__jizz_in_my_pmp3/ 0 1 0 15795 0 0 /entra-cp1525n-service-manual/ 0 1 0 13626 0 0 /clase/colectii.Class.php 0 1 0 0 0 0 /images/galerie/large/40.jpg 0 1 0 0 0 0 /titany-soft-kitty-sheet-music-piano/ 0 2 0 29534 1 0 /fckeditor/editor/skins/office2003/images/toolbar.end.gif 0 1 0 0 0 0 /images/produse/12627927.410_n_albastru.jpg 0 1 0 0 0 0 /disassembling-iona-open-sky-megaupload/ 0 1 0 14170 0 0 /gayboy-gorilla-zoe-daydreamer/ 0 1 0 13677 0 0 /images/content_top.png 0 1 0 518 0 0 /yeare-18wofsteelextremetrucker2wwra/ 0 1 0 15349 0 1 /deb-deskbabe-full-show-video-rartorrent/ 0 1 0 14582 0 0 /sugar-psycho-thrillers-cold-kills-lawyer-raped-strangled/ 0 6 0 84 2 2 /elliptical/Faber.php 0 1 0 0 0 0 /corvallis-68-pages-avi/ 0 1 0 13501 0 0 /larceny-bleach_flash_gamerar/ 0 1 0 14302 0 0 /images/fancy_shadow_w.png 0 2 0 140 0 0 /cavailer-live-at-the-dome/ 0 1 0 14368 0 0 /dakotoa-steinberg-hypersonic_1-exe/ 0 2 0 29614 1 0 /breadmolds-sothink-swf-portable/ 0 1 0 15004 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/32/xls.gif 0 1 0 0 0 0 /kalk-erotical-night-free/ 0 2 0 27866 1 0 /fisiere/1(1).jpg 0 1 0 0 0 0 /kazinski-saflashplayer/ 0 1 0 13568 0 0 /images/produse/1113127.341.jpg 0 1 0 0 0 0 /battat-biohemija-lijekovapdf/ 0 2 0 28690 0 0 /haifa-jeenfr-luupz/ 0 1 0 14924 0 0 /images/produse/10027.655_n_m.jpg 0 1 0 0 0 0 /blazed-mtk_phonesuite_6235rar/ 0 1 0 14527 0 0 /guy-egenda_garota_interrompida/ 0 1 0 13558 0 1 /europeon-physx_9100514_systemsoftware_2/ 0 1 0 14836 0 0 /plunge-bagindasmp3/ 0 1 0 13966 0 0 /compasses-rosskempbackonthefrontlines01e02avi/ 0 1 0 14553 0 1 /flips-td-corrig-circuits-pneumatiques/ 0 2 0 26574 0 1 /heming-adobe-creative-suite-55-design-premium-mac/ 0 1 0 14203 0 1 /navigatio-free-zynga-gold-gen-v6/ 0 1 0 15661 1 0 /outlet/styles.css 0 4 0 4460 0 0 /content/recuperare_parola.php 0 1 0 1060 0 0 /plunge-how-to-find-burnt-resistor-value/ 0 2 0 32230 1 1 /protectors-manfaat-belut-bagi-kesehatan-doc/ 0 1 0 13853 1 0 /fckeditor/editor/filemanager/browser/default/images/FolderOpened.gif 0 1 0 0 0 0 /winberg-don-carlos-score-pdf/ 0 1 0 13661 0 0 /diagraeme-kareenakapoordabooratnanicalender2012/ 0 2 0 28922 0 1 /erection-naho-tateno/ 0 1 0 15261 0 0 /webalizer/ctry_usage_201111.png 0 1 0 4505 0 0 /images/master.jpg 0 1 0 2700 0 0 /fckeditor/editor/filemanager/browser/default/frmresourcetype.html 0 1 0 1899 1 0 /webalizer/daily_usage_201006.png 0 1 0 0 0 0 /rally-piezosurgery-pdf-download/ 0 8 0 112 6 4 /ngn-ensiame-plaquette-cpp-pdf/ 0 1 0 14018 0 0 /images/produse/10484827.297.jpg 0 1 0 0 0 0 /blaire-brotha-lynch-so-help-me-god-download/ 0 1 0 14539 1 0 /images/galerie/thumb/38.jpg 0 1 0 0 0 0 /fisiere/16(2).jpg 0 1 0 0 0 0 /ers-marami-pang-marianet-ang-magpapakamatay/ 0 1 0 13461 0 0 /fckeditor/editor/plugins/bbcode/ 0 1 0 861 0 1 /fckeditor/editor/filemanager/browser/default/images/icons/32/avi.gif 0 1 0 0 0 0 /icc-kinect_viewer/ 0 3 0 44091 2 0 /david.jpg 0 3 0 60952 0 0 /fisiere/14_1(4).jpg 0 1 0 0 0 0 /images/deschis_left.gif 0 1 0 0 0 0 /northstarcadillac-secuencias-numericas-del-0-al-101ro-basico/ 0 4 0 57944 3 1 /images/produse/11954827.553.jpg 0 1 0 0 0 0 /todisc-sex_from_behind_redtube_free_porn_videos_movies__clips/ 0 1 0 14388 0 0 /webalizer/ctry_usage_201009.png 0 1 0 0 0 0 /fckeditor/fckconfig.js 0 1 0 14183 0 0 /clase/my_fonts/ 0 1 0 1398 0 0 /norwich-mathematische-grundlagen-1141/ 0 2 0 30618 1 1 /shootout-little-russian-girl/ 0 1 0 15234 0 0 /onil-van-dale/ 0 1 0 14017 0 0 /spuare-temas-xxx-para-nokia-5200-gratis/ 0 1 0 15131 0 0 /cofes-sleeping-sinengel-2010rar/ 0 2 0 33294 0 1 /claussen-hunter-hunter-297-jpn/ 0 1 0 14531 0 0 /mostfet-hvor-mange-procent-afviger-eratosthenes-beregning-fra-din-beregning/ 0 1 0 14176 0 0 /modgule-venus-hogtied/ 0 1 0 14430 0 0 /softail-brasfoot-2012-rar/ 0 1 0 14976 0 0 /clase/validare.Class.php 0 1 0 0 0 0 /partout-digimon-4-kazemon-hentai/ 0 1 0 14396 0 0 /images/produse/11681227.719__n.jpg 0 1 0 0 0 0 /pfister-screenhunterexe/ 0 1 0 14359 0 0 /vogue-rec-3-dvdrip-french/ 0 1 0 14396 0 0 /electrod-puyo-puyo-box-19xxcompilejp/ 0 1 0 13206 0 0 /dieseling-delf-a2-download/ 0 1 0 13709 1 0 /images/produse/15878027.398_n_roz.jpg 0 1 0 0 0 0 /inoculation-qube-incubate-mediafire/ 0 1 0 14327 0 0 /cams-adikos_kosmoswindowssitx/ 0 1 0 13606 0 0 /endometrium-windows-7-ultimate-32-64bit-activator-keygen/ 0 2 0 15299 1 0 /fckeditor/editor/filemanager/browser/default/images/icons/32/exe.gif 0 1 0 0 0 0 /disassembling-the-librarian/ 0 4 0 64252 3 1 /fisiere/11(3).jpg 0 1 0 0 0 0 /images/item_email.png 0 1 0 659 0 0 /fckeditor/editor/filemanager/browser/default/js/ 0 1 0 912 1 1 /template/html.php 0 1 0 519 0 0 /brassworks-paradise-city/ 0 1 0 15350 1 0 /mediums-uncharted_2__among_thieves_ign_insiderpdf/ 0 1 0 13760 0 0 /colring-douches-froides/ 0 1 0 14137 0 0 /fisiere/1(2).jpg 0 1 0 0 0 0 /drawbacks-indir-extra-boy-dll/ 0 1 0 13423 0 0 /images/produse/16965927.055_n_m.jpg 0 1 0 0 0 0 /adjectivefor-fenn-hong-kong-pfui-complete-german-fs-dtv-divx/ 0 1 0 14130 0 0 /grates-mass-effect-3-disc-1/ 0 1 0 14881 0 0 /doa-dzsingiszkn/ 0 1 0 14330 0 0 /fckeditor/fckeditor.asp 0 1 0 6508 0 0 /halbach-pc-crack-for-nfs-underground-2/ 0 1 0 14598 0 0 /stumbnle-british-invasion-sophie-dee/ 0 1 0 13706 0 0 /atrichia-e1080tjpij2/ 0 2 0 27724 1 0 /colons-raffaella-carra/ 0 1 0 14017 0 0 /ditroit-scholarlibvtedu103227/ 0 1 0 14584 0 0 /seatbealt-digitizer-10000/ 0 1 0 13962 0 0 /webalizer/ctry_usage_201110.png 0 1 0 0 0 0 /fisiere/16_1(1).jpg 0 1 0 0 0 0 /disassembling-metin-sk-yar-bana-daglar-taslar-bilke-aglad/ 0 2 0 28088 1 1 /unrefined-six-sense/ 0 1 0 14152 0 0 /dich-1-side-sex-videotorrent/ 0 2 0 25918 0 0 /webalizer/ctry_usage_200909.png 0 1 0 3582 0 0 /outlet/js/lightbox.js 0 4 0 25108 0 0 /chevrole-java-server-programming-for-professionals-3rd/ 0 2 0 28624 1 0 /js/jquery.fancybox-1.2.1.pack.js 0 3 0 24909 0 0 /sywstem-dong-rider/ 0 2 0 30396 1 0 /camile-fight-club-1999-bdrip-1080p-dts-ita-aac-eng/ 0 2 0 29412 0 0 /retrovirology-dailymotion__spanish_beach_topless__a_sexy_videomp4/ 0 2 0 27372 1 1 /melenium-volkswagen-rcd-510-firmware-upgrade-using-cd/ 0 2 0 30616 1 0 /images/fancy_shadow_e.png 0 1 0 146 0 0 /devilles-n-s-cap-192-480-bakanos-peru-totalh-com-mp4/ 0 1 0 13352 1 0 /images/produse/64179227.228_n_m.jpg 0 1 0 0 0 0 /content/cauta.php 0 1 0 0 0 0 /trivent-playmate-girls-avi/ 0 1 0 12856 0 0 /images/galerie/thumb/03.jpg 0 1 0 0 0 0 /fckeditor/editor/skins/office2003/images/toolbar.separator.gif 0 1 0 0 0 0 /images/galerie/large/09.jpg 0 1 0 0 0 0 /outlet/ 0 38 0 271683 27 16 /glacier-son-fucks-russian-mom/ 0 2 0 28934 0 0 /fckeditor/editor/filemanager/browser/default/images/icons/js.gif 0 1 0 0 0 0 /firebrick-vmware-icm-5/ 0 1 0 13739 0 0 /template/header.php 0 3 0 5688 0 0 /teaher-jorge-mautner/ 0 3 0 43428 2 1 /fckeditor/ 0 9 0 29952 1 1 /ballgowns-kakkmadafakka-all-tracks/ 0 1 0 14806 0 0 /images/produse/1085927.120_n_m.jpg 0 2 0 0 0 0 /kjt-ada-sait-pas-dire-non/ 0 1 0 14967 0 0 /mop-motd2180212/ 0 2 0 28694 1 0 /cases-alicia-keys-no-one/ 0 2 0 29294 1 0 /images/produse/14287927.030_n.jpg 0 1 0 0 0 0 /downtown-get-data-recovery/ 0 1 0 14779 0 0 /endometrium-badhan/ 0 1 0 14308 0 0 /treadted-couple-cuckold/ 0 2 0 28158 0 0 /subersible-stupri-brutali-di-signore-borghesi/ 0 3 0 43020 2 1 /highj-rejeitadas-do-orkut-fotos/ 0 2 0 27762 0 0 /seltzer-tdu2kdgenerlslast7zip/ 0 1 0 14284 0 0 /druker-en-febrero-baby-cris-mp3-4shared/ 0 6 0 84 4 1 /tailpiece-navitel-zemelapiai-gps-goclever-navi-500/ 0 1 0 13610 0 0 /images/fancy_shadow_nw.png 0 1 0 207 0 0 /contributing-zettai-ryouiki-newapk-full/ 0 1 0 14069 0 0 /enforced-planete-nature-ausecours-de-lile-tropicale/ 0 1 0 14622 0 0 /perfarmance-virtual-dj/ 0 1 0 14652 0 0 /bob-elementary-solid-state-physics-rapidshare/ 0 1 0 15428 0 1 /brassworks-legostarwarsiiitheclonewarspccrackhttpdaddyfiledircomsearchb9932chm/ 0 1 0 14428 0 0 /corvallis-renault-dialogys-3/ 0 1 0 14787 0 0 /images/input.gif 0 1 0 0 0 0 /disorientation-empiresandallieshacktrainerv541passwordxvidmp4/ 0 1 0 14826 0 0 /fckeditor/editor/dialog/fck_select/ 0 2 0 1502 1 1 /wander-ktr2012v2rar/ 0 1 0 13476 0 0 /korban-le-francais-du-tourisme-manuel-cd-audio-free/ 0 1 0 13735 1 1 /warcraft-underworld-awakening-eng-2012/ 0 7 0 108373 6 0 /images/contul_meu.jpg 0 1 0 0 0 0 /mccarthy-totaledit-pro-5-4-7-incl-crack-zip/ 0 1 0 14344 0 0 /painting-download-g4u-pdf/ 0 1 0 15058 0 0 /content/login.php 0 1 0 1467 0 0 /images/produse/11260727.306_roz.jpg 0 1 0 0 0 0 /fckeditor/editor/skins/default/images/toolbar.start.gif 0 1 0 0 0 0 /fckeditor/editor/dialog/common/images/unlocked.gif 0 1 0 0 0 0 /fckeditor/editor/skins/silver/images/toolbar.separator.gif 0 1 0 0 0 0 /equation-il-trono-di-spade-1-stagione-italian-torrent/ 0 1 0 14635 0 0 /atkexotics-victor-e-leo-lagrimas-4shared/ 0 2 0 30046 0 0 /images/produse/16833927.380_n_m.jpg 0 1 0 0 0 0 /content/default.php 0 1 0 365 0 0 /culbert-halstead_ace_gc_4733315fullpdf/ 0 1 0 14269 0 0 /geo-debranding-vodafone-k3565-z-free-software/ 0 1 0 13153 1 0 /fisiere/18(1).jpg 0 1 0 0 0 0 /images/produse/11666227.311_n.jpg 0 1 0 0 0 0 /pelle-choufli-hal-2006-episode-11/ 0 2 0 28160 2 2 /picudilla-multilizer-traductor-pro-pdf/ 0 3 0 46443 2 2 /feb-a-dictionary-of-angels/ 0 1 0 14494 0 0 /watermelon-halfaxa/ 0 1 0 15232 0 0 /css/ 0 8 0 6192 1 1 /foote-los-2-hijos-de-francisco/ 0 1 0 15042 0 0 /ajax/ 0 8 0 7168 1 1 /fckeditor/_samples/ 0 3 0 3492 2 1 /jayfllight-mediafire-paramore-final-riott/ 0 1 0 13980 0 0 /drowned-download-asio4all-v2-10/ 0 2 0 28136 1 1 /stiking-tekken5-part3-rar/ 0 2 0 28506 0 1 /godly-rad-racer-nes/ 0 1 0 13472 0 0 /picudilla-fakenudesofjuliechenwindows7zip/ 0 1 0 13910 0 0 /fckeditor/fckeditor_php5.php 0 3 0 10 0 0 /goucho-exploring-chemical-analysis-4th-edition-harris-solutions-pdf/ 0 5 0 70 1 0 /emargency-spy-kids-nederlands-gesproken/ 0 2 0 27072 2 1 /taursus-answer_key_auditing_theory_by_salosagcol_2011_crackrar/ 0 1 0 15908 1 1 /ajax/contact.php 0 3 0 606 0 0 /fisiere/14(7).jpg 0 1 0 0 0 0 /flexsteel-google-chrome-3-0-195-33/ 0 3 0 45066 2 2 /images/produse/16141727.223.jpg 0 1 0 0 0 0 /wed-dead-head-fredcsorar/ 0 2 0 31280 0 0 /ajax/info.php 0 1 0 69 0 0 /equalized-monjas-xxx/ 0 1 0 15771 0 0 /webalizer/daily_usage_201003.png 0 1 0 0 0 0 /aster-the-hunger-games-pdf-full-book/ 0 2 0 27864 1 1 /icons/back.gif 0 35 0 6912 0 0 /outlet/js/jquery.js 0 4 0 402268 0 0 /hydron-lecture-notes-on-econometrics/ 0 2 0 29334 1 1 /sms-boeren-muziek/ 0 1 0 14787 0 0 /orpington-spartito-pianoforte-colonna-sonora-hachiko-gratis/ 0 1 0 14858 0 0 /acce-the-avengers-assemble-2012/ 0 5 0 70 2 2 /fisiere/11(5).jpg 0 1 0 0 0 0 /images/produse/10742627.551_n.jpg 0 1 0 0 0 0 /popsicle-castingcallsdallas2011shannonzip/ 0 1 0 14729 0 0 /graphing-el-guarda-espaldas-avi-taringa/ 0 1 0 13627 0 0 /pentelhudas-pingwinek-kelvin-downloads/ 0 1 0 14753 0 0 /monk-icofx_software_icofx_21_multilingual/ 0 1 0 15431 0 0 /images/produse/10439327.697.jpg 0 1 0 0 0 0 /rolland-mama-ngentot-anak/ 0 1 0 14052 0 0 /flyhwheel-isuzu/ 0 2 0 27410 0 0 /evapt-bf3-full-game/ 0 1 0 13759 0 1 /template/ 0 4 0 4076 1 0 /billings-schoolboysecrets-taringa/ 0 2 0 28192 1 1 /bg.jpg 0 1 0 0 0 0 /images/produse/14847927.506_n_m.jpg 0 1 0 0 0 0 /images/fancy_shadow_s.png 0 1 0 136 0 0 /admin/ 0 6 0 11652 2 1 /highj-neil-zaza-melodica/ 0 1 0 13317 0 0 /yioutube-gestaltterapiacomcrianaebookpdf/ 0 1 0 14332 0 0 /fckeditor/editor/dialog/fck_about/sponsors/spellchecker_net.gif 0 1 0 1447 0 0 /entra-colligative-properties-pdf/ 0 2 0 28728 0 0 /nteractive-descargar-counter-strike-source-gratis/ 0 1 0 15745 0 0 /fckeditor/editor/dialog/fck_about.html 0 1 0 5684 1 0 /lohan-vai-toma-dormindo-4shatred/ 0 1 0 14707 0 0 /images/galerie/thumb/12.jpg 0 1 0 0 0 0 /fckeditor/fckeditor_php4.php 0 3 0 10 0 0 /envirofire-kadhal-video/ 0 2 0 29570 0 0 /clase/produse.Class.php 0 1 0 0 0 0 /elenatera-einstuerzende_neubauten__strategies_against_architecture_iv_2002__2010_part_ii_freesetupiso/ 0 2 0 27072 0 1 /images/fancy_shadow_ne.png 0 1 0 245 0 0 /billy-download-spartacus-vengeance-s02e07/ 0 1 0 14901 0 0 /deloitte-intuitive-analog-circuit-design-download/ 0 2 0 30178 1 1 /fans-sims3-no-cd/ 0 1 0 15555 0 0 /images/produse/13101127.468_n.jpg 0 1 0 0 0 0 /samsanite-rickie-lee-jones-magazine-remastered-sacd/ 0 2 0 29118 0 0 /images/banner/ 0 2 0 2314 1 1 /coratic-cfsp-exam-material/ 0 1 0 13853 0 0 /korban-color__long_distancezip/ 0 1 0 14709 0 0 /minimite-papagoforsamsunggalaxytab7plus1080bpsmkv/ 0 2 0 27680 1 0 /fckeditor/editor/css/images/fck_pagebreak.gif 0 1 0 0 0 0 /fisiere/16(5).jpg 0 1 0 0 0 0 /fckeditor/editor/images/smiley/msn/ 0 1 0 3338 1 1 /default/favicon.png 0 10 0 5180 0 0 /harmor-behringer-energy-x-t-2-5/ 0 1 0 13759 0 0 /tighening-liebherr-576/ 0 4 0 56124 3 1 /asses-madonna-collection/ 0 1 0 14179 0 0 # End Of Table - urls # -sites- (monthly) baiduspider-220-181-108-181.crawl.baidu.com 0 1 0 1832 0 0 - 199.19.249.196 0 3 1 186530 1 1336053466 - 119.63.196.120 0 1 0 1832 0 0 - 78.134.25.226 0 10 6 401302 1 1336233790 - cs27008198.pp.htv.fi 0 7 6 395436 1 1336415285 /aboriginals/ 119.63.196.125 0 1 1 14486 1 1336509184 /northstarcadillac-secuencias-numericas-del-0-al-101ro-basico/ raq2133.uk2.net 0 1 1 3441 1 1336699124 / msnbot-65-52-111-221.search.msn.com 0 10 10 190256 1 1336295500 /outlet/ 119.63.196.46 0 1 0 1832 0 0 - 78.96.101.171 0 28 24 500635 1 1336390350 /webalizer/ 119.63.196.58 0 1 1 14486 1 1336501375 /northstarcadillac-secuencias-numericas-del-0-al-101ro-basico/ 50.22.186.33-static.reverse.softlayer.com 0 1 1 15480 1 1336293034 /warcraft-underworld-awakening-eng-2012/ 96.44.46.187.isp.timbrasil.com.br 0 5 5 54179 1 1336012214 /aboriginals/ 119.63.196.62 0 1 1 14294 1 1336734400 /grados-zs211_drv_6211_070704_setupexe/ 39.216.85.130 0 3 1 3950 1 1336417524 /endometrium-windows-7-ultimate-32-64bit-activator-keygen/ 186.9.192.248 0 11 8 403015 1 1336282286 - 61-111-15-30.kidc.net 0 2 2 7008 0 0 - adsl-165-145-76.teol.net 0 2 1 32005 0 0 - host-155.ipnext.net.ar 0 1 1 9552 1 1336386043 /outlet/ gg-in-f81.1e100.net 0 1 1 14686 1 1337497069 /equalized-sonohanabirawatchonline1080bpszip/ sticker00.yandex.ru 0 30 20 87140 5 1337419924 / bardolino4.netestate.de 0 1 1 3441 1 1336405127 / static-208-80-194-33.as13448.com 0 1 1 3429 1 1337044785 / crawl-66-249-66-162.googlebot.com 0 21 4 21898 2 1336057604 /webalizer/ 178-25-230-211-dynip.superkabel.de 0 1 1 3429 1 1337354300 / pd9fd53.iskwnt01.ap.so-net.ne.jp 0 2 1 42998 0 0 - ip-176-195-47-68.bb.netbynet.ru 0 1 1 54399 0 0 - baiduspider-180-76-5-54.crawl.baidu.com 0 1 1 14476 1 1336153618 /teaher-jorge-mautner/ bardolino.netestate.de 0 3 1 7105 1 1336411860 / wg-in-f216.1e100.net 0 1 1 15308 1 1336512264 /melenium-volkswagen-rcd-510-firmware-upgrade-using-cd/ 173-162-199-185-newengland.hfc.comcastbusiness.net 0 11 7 725659 1 1336506807 /aboriginals/ 114-33-161-104.hinet-ip.hinet.net 0 2 1 42998 0 0 - 50.23.91.94-static.reverse.softlayer.com 0 1 1 15480 1 1336049870 /warcraft-underworld-awakening-eng-2012/ 10-209-245-216.reverse.lstn.net 0 1 1 3441 1 1336259775 / host22.190-229-129.telecom.net.ar 0 1 1 15706 1 1337119466 /boatmotors-virtual-date-games-sci-fi-mission-walkthrough/ baiduspider-123-125-71-31.crawl.baidu.com 0 1 1 15562 1 1337324308 /fuil-1102/ baiduspider-123-125-71-35.crawl.baidu.com 0 1 1 13826 1 1336156345 /communit-damian-lazarus/ msnbot-65-52-111-206.search.msn.com 0 10 10 190097 1 1336325973 /outlet/ baiduspider-123-125-71-114.crawl.baidu.com 0 2 1 16399 1 1336174432 /mfgs-014111pdfd189484068/ 31.41.13.155 0 1 0 1832 1 1336852514 / 180.76.6.222 0 1 1 3441 1 1336087486 / 180.76.6.223 0 1 1 14 1 1336367686 /kenworths-peranan-pendidikan-dalam-masyarakat-pdf/ wtp-g3-maya4.sjdc 0 1 1 391839 1 1336139351 /aboriginals/ 69.50.215.127 0 1 1 13883 1 1336396009 /rights-hip-hop-drums-xxl/ baiduspider-123-125-71-71.crawl.baidu.com 0 1 0 1832 0 0 - baiduspider-220-181-108-173.crawl.baidu.com 0 1 1 3441 1 1335900796 / 41.131.244.124 0 9 8 399263 2 1337420676 / baiduspider-123-125-71-75.crawl.baidu.com 0 1 0 1832 0 0 - 180.76.6.230 0 2 2 29194 2 1337467140 /orpington-fasciola-in-sheep/ 180.76.6.231 0 1 1 13892 1 1337445523 /protien-the-number-one-asset-you-should-own-in-a-time-of-crisis-full-free/ 180.76.6.233 0 2 1 16390 1 1337528301 /ladt-hall-sekly-vzben/ c-75-70-93-54.hsd1.co.comcast.net 0 8 6 397638 1 1337094913 - 74-82-68-18.rdns.blackberry.net 0 3 1 3812 1 1336517640 - 109.96.161.44 0 2 1 42998 0 0 - msnbot-65-52-111-141.search.msn.com 0 10 10 189464 1 1336122254 /outlet/ crawl-66-249-66-104.googlebot.com 0 43 42 610771 7 1336071327 /doa-solution_statistical_quality_control_montgomeryfullrar/ 183.80.159.201 0 1 1 251 1 1336242189 /sdsale-xvideos-love/ baiduspider-123-125-71-97.crawl.baidu.com 0 1 0 1832 0 0 - 31.41.11.106 0 3 0 5496 0 0 - p5dc0ddaf.dip.t-dialin.net 0 16 7 789916 1 1336329520 /aboriginals/ static-208-80-194-32.as13448.com 0 1 1 3429 1 1336649797 / crawl-66-249-71-138.googlebot.com 0 26 10 129121 8 1337264564 /outlet/ 178-137-82-160-lvv.broadband.kyivstar.net 0 1 1 15150 1 1337447309 /orpington-fasciola-in-sheep/ nfmv001103214.uqw.ppp.infoweb.ne.jp 0 2 1 17364 0 0 - 188-24-236-77.rdsnet.ro 0 3 3 32362 1 1336452312 /iassic-honda-whereis-navigation-data-au/ z46-13.opera-mini.net 0 4 2 85996 0 0 - dsl-189-234-163-111-dyn.prod-infinitum.com.mx 0 2 1 2054 1 1336806383 /feb-solucionario-larson-8-edicion-pdf/ pd95e6f70.dip.t-dialin.net 0 6 5 395288 1 1336063363 /aboriginals/ 2.red-79-144-127.dynamicip.rima-tde.net 0 6 5 395288 1 1337456504 /aboriginals/ 200.174.238.46 0 8 5 398952 1 1337029590 /aboriginals/ baiduspider-180-76-5-113.crawl.baidu.com 0 1 0 1832 0 0 - 180.76.6.21 0 1 1 16063 1 1336411271 /disassembling-the-librarian/ 212.113.37.105 0 1 0 1832 0 0 - 203.130.233.180 0 5 5 393456 1 1336137798 /aboriginals/ 188-24-14-231.rdsnet.ro 0 12 9 406368 1 1337550722 / 180.76.6.36 0 1 1 16115 1 1337478021 /sdsale-download-free-chix-loving-black-dicks-3/ baiduspider-180-76-5-139.crawl.baidu.com 0 1 1 13832 1 1336122799 /empty-wadca-piercieni/ 78.96.184.116 0 14 11 33510 1 1337002620 /webalizer/ abcd-ovh1.yasni.de 0 2 2 29664 2 1337293257 /sdsale-xvideos-love/ hosted-by.leaseweb.com 0 4 2 10522 2 1337083197 / net-37-116-36-58.cust.dsl.vodafone.it 0 3 1 3888 1 1336646205 /igntion-discografia-flotsam-and-jetsam-mediafire/ 92.f5.344a.static.theplanet.com 0 1 1 3429 1 1336816236 / baiduspider-180-76-5-157.crawl.baidu.com 0 1 1 14881 1 1336480223 /ballancing-la-vita-atildeuml-bella/ 188.123.241.158 0 1 1 13952 1 1336692407 /kicken-smell-like-sex/ msnbot-157-55-18-24.search.msn.com 0 4 2 22632 2 1337315109 /outlet/ crawl-66-249-72-97.googlebot.com 0 519 501 6715816 47 1336412738 /minatures-kudakuda-doc/ baiduspider-220-181-108-110.crawl.baidu.com 0 1 0 1832 0 0 - crawl06.exabot.com 0 16 8 92975 9 1337530497 /admin/ baiduspider-123-125-71-16.crawl.baidu.com 0 1 0 1832 0 0 - 115.249.130.45 0 4 4 208807 1 1336045669 /aboriginals/ baiduspider-180-76-5-60.crawl.baidu.com 0 1 0 1832 0 0 - 78.8.207.91.unknown.steephost.net 0 21 6 1719891 1 1335863237 - 208.115.113.87 0 78 50 721866 28 1337553994 /ibra-crack-adobe-photoshop-elements-10/ sticker01.yandex.ru 0 21 14 60998 7 1337492248 / 208-115-111-71-reverse.wowrack.com 0 63 43 635365 20 1337565089 /mehren-dvd-flick-1307-__-keygen-__/ crawl-66-249-71-203.googlebot.com 0 31 7 43744 3 1337258954 /fckeditor/editor/filemanager/browser/default/frmresourcetype.html 213.186.127.13.utel.net.ua 0 6 6 20646 6 1337377412 / baiduspider-180-76-5-193.crawl.baidu.com 0 1 0 1832 0 0 - baiduspider-123-125-71-49.crawl.baidu.com 0 1 0 1832 0 0 - baiduspider-180-76-5-197.crawl.baidu.com 0 1 1 16063 1 1337417073 /disassembling-the-librarian/ baiduspider-180-76-5-93.crawl.baidu.com 0 1 0 1832 0 0 - 188-27-104-59.rdsnet.ro 0 1 1 13862 1 1336767465 /atrichia-e1080tjpij2/ crawl-66-249-72-57.googlebot.com 0 24 22 196360 4 1336447268 /abandom-videos-insesto-madre-hijo-gratis/ baiduspider-180-76-5-97.crawl.baidu.com 0 1 0 1832 0 0 - msnbot-65-52-109-200.search.msn.com 0 6 3 23530 3 1337425276 /outlet/ 176.4.1.133 0 9 6 399470 1 1336173139 - crawl-66-249-72-68.googlebot.com 0 230 159 2296992 76 1337557878 /protien-the-number-one-asset-you-should-own-in-a-time-of-crisis-full-free/ 95-27-153-67.broadband.corbina.ru 0 1 1 3429 1 1337282249 / 130.red-83-41-105.dynamicip.rima-tde.net 0 2 1 2077 1 1335992617 /aftermaeket-carib-whole-hd2/ 176.65.164.111 0 1 1 15532 0 0 - baiduspider-123-125-71-85.crawl.baidu.com 0 1 1 13826 1 1336226005 /communit-damian-lazarus/ msnbot-207-46-195-236.search.msn.com 0 2 1 5273 1 1335876305 / crawl-66-249-72-72.googlebot.com 0 64 32 320371 24 1336421707 /webalizer/ host109.190-137-136.telecom.net.ar 0 1 1 15706 1 1337119406 /boatmotors-virtual-date-games-sci-fi-mission-walkthrough/ p4fc0ae11.dip.t-dialin.net 0 11 6 403134 1 1336437123 - client-77-81-144-221 0 6 5 395288 1 1337430616 /aboriginals/ msnbot-157-55-16-222.search.msn.com 0 2 1 10618 1 1336119138 /outlet/ 23.20.239.199 0 1 1 3429 1 1336077028 / dynamic-adsl-78-15-211-24.clienti.tiscali.it 0 1 1 15706 1 1336009924 /boatmotors-virtual-date-games-sci-fi-mission-walkthrough/ 74-82-68-17.rdns.blackberry.net 0 1 1 245 0 0 - 173.193.77.16-static.reverse.softlayer.com 0 1 1 15480 1 1336210546 /warcraft-underworld-awakening-eng-2012/ static-173-212-140-21.ptr.terago.net 0 1 1 3441 1 1336419000 / cpe-098-122-044-076.sc.res.rr.com 0 7 5 397120 1 1336627441 /aboriginals/ 64.211.102.18 0 6 5 395288 1 1336652458 /aboriginals/ imparser11.yandex.ru 0 5 3 5816 0 0 - 163.143.151.178.triolan.net 0 41 20 108329 1 1336907823 /webalizer/ 139.179.197.25 0 6 5 395288 1 1336618249 /aboriginals/ baiduspider-180-76-5-149.crawl.baidu.com 0 1 1 14328 1 1336281264 /leveled-lisasoghayaramp3r/ yn-in-f89.1e100.net 0 1 1 14686 1 1337497068 /equalized-sonohanabirawatchonline1080bpszip/ 211.254.252.220 0 2 2 65845 0 0 - 109.162.192.244 0 6 5 395288 1 1336932707 /aboriginals/ msnbot-65-52-110-23.search.msn.com 0 2 1 11157 1 1336367826 /outlet/ 175-28-247-91.ppp.bbiq.jp 0 15 1 25879 1 1336925991 /dispener-gforcemtronprov10vstidxirtasauhybriddvdrdynamics/ crawl-66-249-66-84.googlebot.com 0 3 3 42885 1 1336018692 /haas-led-zeppelin-in-throught-the-out-door-03/ static-208-80-194-30.as13448.com 0 7 7 24003 7 1337240099 / baiduspider-123-125-71-26.crawl.baidu.com 0 1 0 1832 0 0 - cpe-72-191-176-76.elp.res.rr.com 0 5 5 393456 1 1336984451 /aboriginals/ msnbot-157-55-16-56.search.msn.com 0 1 0 1832 0 0 - baiduspider-180-76-5-181.crawl.baidu.com 0 1 1 14568 1 1337488734 /purdom-addicted-dynasty-mediafire/ baiduspider-180-76-5-185.crawl.baidu.com 0 1 1 13541 1 1337431288 /apachi-filme-video-crestine-gratis/ baiduspider-180-76-5-89.crawl.baidu.com 0 1 0 1832 0 0 - msnbot-157-55-16-177.search.msn.com 0 2 0 3664 1 1336939716 - baiduspider-123-125-71-101.crawl.baidu.com 0 1 1 3441 1 1335900780 / msnbot-207-46-199-54.search.msn.com 0 4 2 21242 2 1337270439 /outlet/ 50.23.91.93-static.reverse.softlayer.com 0 1 1 15480 1 1336446541 /warcraft-underworld-awakening-eng-2012/ baiduspider-180-76-5-92.crawl.baidu.com 0 1 1 15014 1 1336144404 /restuarant-arabsquadcombymrhassanomsi_the_bus_simulatorskidrowpart1/ baiduspider-180-76-5-96.crawl.baidu.com 0 1 1 15030 1 1337561660 /killo-bmw-3er-e36-jetzt-helfe-ich-mir-selbst/ baiduspider-220-181-108-157.crawl.baidu.com 0 1 0 1832 0 0 - 173-231-24-142.hosted.static.webnx.com 0 325 137 1627497 2 1336995399 - 173.193.76.208-static.reverse.softlayer.com 0 1 1 15480 1 1336371259 /warcraft-underworld-awakening-eng-2012/ static-208-80-194-35.as13448.com 0 1 1 3429 1 1336681453 / 178-137-160-135-lvv.broadband.kyivstar.net 0 1 1 14762 1 1337543249 /svbd-raccolta-video-musicali-italia/ baiduspider-220-181-108-175.crawl.baidu.com 0 1 0 1832 0 0 - baiduspider-123-125-71-73.crawl.baidu.com 0 1 0 1832 0 0 - arennes-359-1-210-180.w2-2.abo.wanadoo.fr 0 7 5 397120 1 1336695917 /aboriginals/ 173.193.77.44-static.reverse.softlayer.com 0 1 1 60057 0 0 - s1.960.clients.serverdeals.org 0 10 4 26963 4 1336532165 / 210.97.192.200 0 2 2 65845 0 0 - 14.140.86.34.static-hyderabad.vsnl.net.in 0 8 6 397638 1 1336053466 - static.173.114.63.178.clients.your-server.de 0 6 6 20646 3 1336678059 / wvps178-77-66-56.dedicated.hosteurope.de 0 2 2 6882 1 1336281311 / abcd-ovh4.yasni.de 0 10 10 148320 7 1337504397 /sdsale-xvideos-love/ 210.97.192.210 0 1 1 3504 0 0 - 178-27-210-56-dynip.superkabel.de 0 7 5 397120 1 1336637779 /aboriginals/ 210.97.192.230 0 1 1 6345 0 0 - 176.65.167.243 0 2 2 5642 0 0 - ip70-162-215-80.ph.ph.cox.net 0 9 6 399470 1 1337369680 - 210.97.192.240 0 1 1 62341 0 0 - 159.253.131.197-static.reverse.softlayer.com 0 1 1 15480 1 1336528331 /warcraft-underworld-awakening-eng-2012/ msnbot-157-55-17-150.search.msn.com 0 8 0 12824 4 1336969805 - msnbot-207-46-204-205.search.msn.com 0 9 9 187836 1 1336313323 /outlet/ baiduspider-180-76-5-144.crawl.baidu.com 0 1 0 1832 0 0 - 92.81.176.96 0 8 6 397638 1 1336840536 - 74-82-68-16.rdns.blackberry.net 0 6 5 436579 1 1336517419 /aboriginals/ fer13-3-88-176-24-240.fbx.proxad.net 0 6 5 395288 1 1335938487 /aboriginals/ e87091.upc-e.chello.nl 0 2 1 5273 1 1336753449 / baiduspider-180-76-5-48.crawl.baidu.com 0 1 1 15163 1 1336181916 /orpington-fasciola-in-sheep/ 95.77.130.200 0 1 1 391839 1 1336474121 /aboriginals/ 67.221.255.12 0 500 500 0 10 1337165612 / spider-77-88-43-27.yandex.com 0 146 52 689760 82 1337565708 /webalizer/ baiduspider-180-76-5-51.crawl.baidu.com 0 1 1 12982 1 1336208678 /hospitals-dbh_tenth_anniversary_editionzip/ baiduspider-123-125-71-14.crawl.baidu.com 0 2 1 14985 1 1336371298 /geo-debranding-vodafone-k3565-z-free-software/ baiduspider-180-76-5-166.crawl.baidu.com 0 1 1 3441 1 1336822793 / msnbot-207-46-204-162.search.msn.com 0 1 1 466 1 1336403448 /outlet/ ey-in-f102.1e100.net 0 1 1 13761 1 1336230821 /gayboy-hardteksamplepackcracksitx/ baiduspider-180-76-5-62.crawl.baidu.com 0 1 0 1832 0 0 - baiduspider-180-76-5-66.crawl.baidu.com 0 1 1 14788 1 1337506766 /matematik-bakugan-gundalian-invaders-psp/ static.199.176.9.176.clients.your-server.de 0 5 4 28632 2 1337300918 / 180.246.20.228 0 1 1 14633 1 1337143782 /todisc-akita-films/ ip-90-186-79-125.web.vodafone.de 0 2 1 2081 1 1336230983 /gayboy-hardteksamplepackcracksitx/ 95.141.28.57 0 200 200 0 4 1336996991 / softbank218125218096.bbtec.net 0 7 5 397490 1 1336017148 - baiduspider-180-76-5-191.crawl.baidu.com 0 1 1 14328 1 1337456321 /leveled-lisasoghayaramp3r/ msnbot-207-46-204-210.search.msn.com 0 1 1 443 1 1336607557 / baiduspider-123-125-71-104.crawl.baidu.com 0 1 0 1832 0 0 - static-208-80-194-28.as13448.com 0 1 1 3429 1 1335917945 / d24-36-185-208.home1.cgocable.net 0 4 1 20303 1 1336889045 /dakotoa-steinberg-hypersonic_1-exe/ 119.63.196.10 0 1 0 1832 0 0 - msnbot-65-52-104-84.search.msn.com 0 8 0 12824 4 1336858745 - crawl-66-249-72-81.googlebot.com 0 232 60 637011 38 1337556494 /elliptical/ 159.253.143.173-static.reverse.softlayer.com 0 1 1 60057 0 0 - 76.72.167.164 0 5 2 33219 1 1336589620 /elliptical/ baiduspider-123-125-71-72.crawl.baidu.com 0 1 0 1832 0 0 - baiduspider-220-181-108-178.crawl.baidu.com 0 1 0 1832 0 0 - crawl-66-249-66-114.googlebot.com 0 18 6 60105 4 1337079084 /druker-en-febrero-baby-cris-mp3-4shared/ 119.63.196.30 0 1 1 14112 1 1336813793 /scripps-corona__1995__baby_baby_musikarar/ 174-17-254-118.phnx.qwest.net 0 6 5 395288 1 1336383345 /aboriginals/ # End Of Table - sites (monthly) # -sites- (daily) 208-115-111-71-reverse.wowrack.com 0 4 3 44502 1 1337565089 /mehren-dvd-flick-1307-__-keygen-__/ baiduspider-180-76-5-96.crawl.baidu.com 0 1 1 15030 1 1337561660 /killo-bmw-3er-e36-jetzt-helfe-ich-mir-selbst/ spider-77-88-43-27.yandex.com 0 5 3 50700 1 1337565708 /webalizer/ # End Of Table - sites (daily) # -referrers- http://www.google.ro/url 0 5 http://www.davidfashion.ro/template/ 1 4 - (Direct Request) 0 1920 http://davidfashion.ro/fckeditor/ 1 27 http://www.google.co.in/url 0 1 http://www.google.com.tw/url 0 1 http://www.google.com/search 0 8 http://webcache.googleusercontent.com/search 0 11 http://edfaststore.com/ 0 1 http://davidfashion.ro/elliptical/ 1 5 http://www.davidfashion.ro/ 1 32 http://davidfashion.ro/webalizer/ 1 40 http://www.google.ch/url 0 1 http://davidfashion.ro/outlet/index.php 1 35 http://www.google.co.id/search 0 1 http://46.21.100.254/phpdug/ 0 1 http://www.google.com.sg/search 0 1 http://davidfashion.ro/ajax/ 1 7 http://www.google.com.tr/url 0 1 http://targexp.blogspot.com/2009/02/baby-expo.html 0 1 http://yandex.ru/yandsearch 0 1 http://davidfashion.ro/aboriginals/ 1 290 http://web-promotion-services.net 0 1 http://www.seo-linkexchange.com/dnc2/index2.php 0 1 http://davidfashion.ro/ 1 38 http://www.google.com.mx/url 0 1 http://www.google.fi/url 0 1 http://www.google.com/url 0 12 http://www.google.co.jp/search 0 1 http://davidfashion.ro/images/ 1 7 http://davidfashion.ro/clase/ 1 14 http://www.webstatschecker.com/stats/domain/davidfashion.ro 1 1 http://www.fmeter.ru/ 0 700 http://www.google.de/url 0 5 http://davidfashion.ro/content/ 1 21 http://davidfashion.ro/awstats/ 1 5 http://hqeuropewhatches.com/ 0 1 http://davidfashion.ro/css/ 1 6 http://www.google.ba/url 0 1 http://www.google.ru/url 0 1 http://www.google.cl/search 0 1 http://davidfashion.ro/fisiere/ 1 6 http://www.google.co.id/url 0 1 http://davidfashion.ro/fck_files/ 1 4 http://www.google.es/url 0 1 http://davidfashion.ro/js/ 1 9 http://davidfashion.ro/admin/ 1 1 http://www.google.com/m/search 0 2 http://bob.0hna.com/de/ 0 1 http://www.google.fr/url 0 2 http://www.davidfashion.ro/webalizer/webalizer.current 1 4 http://www.google.com.br/url 0 2 http://davidfashion.ro/aboriginals/alicia-keys-no-one.html 1 2 http://www.davidfashion.ro/webalizer/ 1 1 http://www.google.it/url 0 2 # End Of Table - referrers # -agents- Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.0)[ 0 1 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; YPC 3 0 2 Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/536.11 (KHTML 0 8 Mozilla/5.0 (Macintosh; Intel Mac OS X 10_7_3) AppleWebKit/53 0 5 Mozilla/5.0 (iPad; U; CPU OS 4_3_5 like Mac OS X; en-us) Appl 0 1 Mozilla/5.0 (Windows NT 5.1; rv:6.0.2) Gecko/20100101 Firefox 0 9 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.2; SLCC1; . 0 10 Mozilla/5.0 (Linux; U; Android 2.3.4; generic) AppleWebKit/53 0 2 Googlebot-Image/1.0 0 188 Mozilla/5.0 (Macintosh; Intel Mac OS X 10.7; rv:12.0) Gecko/2 0 7 Baiduspider+(+http://www.baidu.com/search/spider.htm) 0 3 Mozilla/4.0 (compatible; ICS) 0 1 Mozilla/5.0 (compatible; YandexImages/3.0; +http://yandex.com 0 5 Mozilla/5.0 (Windows NT 6.1; WOW64; rv:14.0) Gecko/20120505 F 0 6 Mozilla/4.0 (compatible; MSIE 8.0; Windows NT 5.1; Trident/4. 0 2 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; GTB7. 0 5 Mozilla/5.0 (Windows NT 5.1; rv:12.0) Gecko/20100101 Firefox/ 0 32 Opera/9.80 (Windows NT 5.1; U; en) Presto/2.10.229 Version/11 0 6 Mozilla/5.0 (compatible; Baiduspider/2.0; +http://www.baidu.c 0 37 Filecrop/1.2 (http://www.filecrop.com/) 0 1 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; SLCC1; . 0 20 Mozilla/5.0 (Windows NT 5.1; rv:11.0) Gecko/20100101 Firefox/ 0 14 Mozilla/5.0 (iPod; CPU iPhone OS 5_1 like Mac OS X) AppleWebK 0 1 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; .NET 0 3 Mozilla/5.0 (Windows; U; Windows NT 6.1; en-US; rv:1.9.2.13) 0 8 Mozilla/5.0 (Windows NT 6.1; WOW64; rv:12.0) Gecko/20100101 F 0 11 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; .NET4.0C; 0 1 Opera/9.80 (Series 60; Opera Mini/6.5.29700/27.1597; U; sk) P 0 4 Mozilla/5.0 (compatible; Exabot/3.0; +http://www.exabot.com/g 0 16 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; .NET CLR 1 0 2 Mozilla/5.0 (compatible; AhrefsBot/3.0; +http://ahrefs.com/ro 0 7 Opera/9.02 (Windows; U; nl) 0 1 Mozilla/5.0 (Windows NT 6.1) AppleWebKit/535.19 (KHTML, like 0 8 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; .NET CLR 1 0 13 Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/534+ (KHTML, 0 2 Mozilla/5.0 (Windows NT 5.1) AppleWebKit/536.5 (KHTML, like G 0 12 Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/535.11 (KHTML, li 0 1 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1) 0 326 Mozilla/4.0 (compatible; MSIE 7.0b; Windows NT 5.1; .NET CLR 0 5 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; SIMBAR Ena 0 1 Mozilla/4.0 (compatible; MSIE 7.0b; Windows NT 6.0) 0 1 Mozilla/5.0 (X11; Linux x86_64) AppleWebKit/535.1 (KHTML, lik 0 2 Opera/9.00 (Windows NT 5.1; U; en) 0 1 Mozilla/4.0 (compatible; MSIE 5.5; Windows 98) 0 2 Opera/9.80 (Windows NT 6.1; WOW64; U; de) Presto/2.10.229 Ver 0 6 Mozilla/5.0 (compatible; MSIE 9.0; Windows NT 6.1; WOW64; Tri 0 28 Mozilla/5.0 (Windows NT 6.1; rv:9.0) Gecko/20100101 Firefox/9 0 9 Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/535.19 (KHTML 0 738 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; InfoPath.1 0 3 Mozilla/5.0 (compatible; YandexBot/3.0; +http://yandex.com/bo 0 197 Mozilla/4.0 (compatible; MSIE 5.01; Windows NT 5.0) 0 3 Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/536.5 (KHTML, 0 9 Mozilla/5.0 (Linux; U; Android 3.1; ja-jp; L-06C Build/HMJ37) 0 2 Baiduspider-image+(+http://www.baidu.com/search/spider.htm) 0 12 Mozilla/5.0 (Windows NT 6.1; WOW64; rv:2.0.1) Gecko/20100101 0 3 Mozilla/5.0 (compatible; Googlebot/2.1; +http://www.google.co 0 1010 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; IEMB3; .NE 0 1 Mozilla/5.0 (compatible; MJ12bot/v1.4.2; http://www.majestic1 0 1 Mozilla/5.0 (Windows NT 6.1; WOW64; rv:11.0) Gecko/20100101 F 0 10 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; Mozil 0 1 Mozilla/5.0 (Windows NT 6.1; rv:12.0) Gecko/20100101 Firefox/ 0 4 Mozilla/5.0 (Windows NT 5.1) AppleWebKit/535.7 (KHTML, like G 0 3 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1; NJSOA 0 1 Mozilla/5.0 (Windows NT 6.0; rv:2.0.1) Gecko/20100101 Firefox 0 7 Mozilla/5.0 (Windows NT 6.0; rv:12.0) Gecko/20100101 Firefox/ 0 3 Mozilla/5.0 (compatible; Ezooms/1.0; ezooms.bot@gmail.com) 0 141 Mozilla/5.0 (iPhone; U; CPU iPhone OS 4_1 like Mac OS X; en-u 0 13 Mozilla/5.0 (Windows NT 6.2; rv:11.0) Gecko/20100101 Firefox/ 0 8 netEstate NE Crawler (+http://www.sengine.info/) 0 4 Mozilla/5.0 (Windows NT 6.1; WOW64) AppleWebKit/535.1 (KHTML, 0 9 Mozilla/4.0 (compatible; MSIE 6.0; Windows NT 5.1; SV1) 0 1 Mozilla/5.0 (compatible; bingbot/2.0; +http://www.bing.com/bi 0 39 Mozilla/5.0 (Windows NT 6.1; Win64; x64; rv:10.0) Gecko/20120 0 8 Mozilla/5.0 (compatible; MJ12bot/v1.4.3; http://www.majestic1 0 62 BlackBerry8530/5.0.0.654 Profile/MIDP-2.1 Configuration/CLDC- 0 10 Mozilla/5.0 (Windows NT 6.1; rv:10.0) Gecko/20100101 Firefox/ 0 4 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; yie6; YPC 0 1 Mozilla/5.0 (X11; U; Linux i686; en-US; rv:1.7.5) Gecko/20041 0 1 Opera/9.80 (Windows NT 6.1; U; en) Presto/2.10.229 Version/11 0 6 Tcl http client package 2.7.5 0 1 Mozilla/5.0 (compatible; MSIE 9.0; Windows NT 6.0; Trident/5. 0 2 Mozilla/5.0 (X11; Linux i686; rv:6.0) Gecko/20100101 Firefox/ 0 12 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; (R1 1.3); 0 1 Mozilla/5.0 (Macintosh; Intel Mac OS X 10.6; rv:12.0) Gecko/2 0 7 Mozilla/5.0 (compatible; Konqueror/3.0-rc1; i686 Linux; 20020 0 21 Mozilla/5.0 (Linux; U; Android 2.2; ja-jp; MID Build/JIEVIS) 0 2 Mozilla/5.0 (compatible; MSIE 9.0; Windows NT 7.1; Trident/5. 0 6 Mozilla/5.0 (Windows NT 5.1) AppleWebKit/535.19 (KHTML, like 0 7 Mozilla/5.0 (compatible; NetcraftSurveyAgent/1.0; +info@netcr 0 1 Mozilla/4.0 (compatible; MSIE 7.0; Windows NT 5.1; SV1; .NE 0 9 # End Of Table - agents # -search strings- intitle:index.of falk fn9 (torrent) 1 intitle:”index of” ”last modified” ”parent directory 1 uniquesexygirls -inurl:(htm|html|php|asp) intitle:index of 1 intitle:index.of mp4 9 songs 1 « intitle:index.of parent directory » moana cicciolina mp4 1 moescroll intitle:' index of' 1 -imurl:(htn|html|php)intitle:``index of`` ``last modified`` par 1 intitle:index.of exe travian hack 1 xvideo movie japan loan luan 1 www. x videos jeenfr lopes.com 1 -inurl:htm -inurl:html intitle:index of wmv joyangeles 1 # End Of Table - search strings # -usernames- # End Of Table - usernames